Entry information : CsPrx14 (orange1.1g039303m/Cs2g09200)
Entry ID 8867
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang LI)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx14 (orange1.1g039303m/Cs2g09200)
Name (synonym) CsPrx14 (orange1.1g039303m/Cs2g09200)
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx14
start..stop
S start..stop
CclPrx113 342 1e-120 1..171 72..242
CclPrx84 327 5e-115 1..170 73..242
PtPrx40 283 4e-97 1..171 114..284
StPrx25 281 6e-97 1..171 68..238
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1287..1478 192 N° 2 703..868 166 N° 3 5..159 155  
complement(join(5..159,703..868,1287..1478))


exon

Literature and cross-references CsPrx14 (orange1.1g039303m/Cs2g09200)
DNA ref. Citrus sinensis Annotation Project:   chr2 (6427151..6428950) Phytozome 12:   scaffold00244 (1478..5)
Protein sequence: CsPrx14 (orange1.1g039303m/Cs2g09200)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   171
PWM (Da):   %s   17661.63  
PI (pH):   %s   4.36
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCDASVLLDDTSSFTGEKSASANVNSIRGFEVIDSVKSEVESLCPGVVSCADILAVAARDSVVAFGGPSWTVQLGRRDSTTASSSAVNTNIPSPLMDLNDLISNFAKKGLSAKEMVALSGAHTIGQARCLLFRQRIYNETNIDSEFATSLKSNCPSSGGDDNLSSLDATS

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (Both 5' end and 3' end are missing which have not been found yet).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGTTGTGATGCATCAGTTCTATTAGATGACACTTCAAGTTTTACTGGTGAGAAATCAGCCAGCGCCAATGTGAATTCAATAAGAGGCTTCGAAGTGATCGATTCAGTTAAATCTGAAGTT
GAGAGTCTCTGCCCTGGTGTTGTTTCTTGTGCAGACATCTTAGCTGTTGCTGCTCGAGATTCCGTTGTTGCT
GTAAGTGAAGTGAAAATTGCATTAACGACTACTTGAGATTATTGTCAC
CTAATAGTAATAACTGCAGGCCCAAAATCTTAGCACTTTTCTTTATTATTATTGTTGGATCCTTATCATCGACTTAGGCTTAATTTTGGTTAAACGGTTTCTCTAACACAATTAAATTCA
ATTCTCTCAACTTATAAACTCATTCAATTTCTTGATTCACTTTTAAGCTCGTCTTTTGGTACATCCAAAACCTTTTTCTTTTTCCCTTTTTTTTCTTTTTTCCTAATCTTAGCCTACAAA
CATTTCACATAAGGAAGCACATGAAACCCTATCTTATCAGCTTAAACTTTTGGCTAAGCAGTTATTAACAGTATAATGGAATTTTATTTATCAAAATTAATTAATTAATCAGATATTCTT
TTTTGTTCAGTTCGGGGGGCCTTCATGGACAGTTCAATTAGGTAGAAGAGATTCGACAACGGCAAGTTCCAGTGCAGTAAATACTAATATTCCATCCCCTCTCATGGATCTTAATGACCT
TATTTCTAACTTTGCAAAGAAAGGACTCAGTGCTAAAGAAATGGTGGCCCTCTCAG
GTAATAAAATTATTATTAGATTAATAAACTTAGACCTTGTGCTGATCTAAGCTGCACTAATCTT
TCAAAATCATATCTCATCACCTGCACAACCAAAAAAGGCCTCTAGTATCAGTGGATGTACGAGTGCATTAATAACATTGTACGCATGGTAGAATTTAGTTACATATATATACCGTGTAGA
ATGATCAACATAAGATTAGATAAATATTGATATGTATTGAAGATATTATCTCACATCAACTGAGAATAATTACTAGGTTAATAACATAAGTGAGGCAATCCTCAAATCCTAAGCCATTTT
CGGAGTATAAGTTAGGCTCATCAGTTTTTTATATGGTATCAGAGTTAGAGTCAATTACGAGTGGGATCACTCTACTTTATCGTGTGATAAGGACTAGCTAGGCAAAAAAATCCGTATTGA
GGAGAATATTCCAAGTCAACTATTAACTCAACTAGCTAGCTAGTAGCCATATTCTTTGACGTCTATAATTCTTATTTCGTGTATGATTAATTATATATCAAAATTCTGGTCATATACAGG
AGCTCACACAATAGGACAAGCTAGGTGCTTATTGTTTCGACAAAGAATCTACAATGAAACAAACATTGATTCAGAATTTGCAACATCATTAAAATCAAACTGCCCAAGCTCAGGCGGCGA
TGACAACCTTTCTTCATTAGATGCCACCAGCCCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGTTGTGATGCATCAGTTCTATTAGATGACACTTCAAGTTTTACTGGTGAGAAATCAGCCAGCGCCAATGTGAATTCAATAAGAGGCTTCGAAGTGATCGATTCAGTTAAATCTGAAGTT
GAGAGTCTCTGCCCTGGTGTTGTTTCTTGTGCAGACATCTTAGCTGTTGCTGCTCGAGATTCCGTTGTTGCT
TTCGGGGGGCCTTCATGGACAGTTCAATTAGGTAGAAGAGATTCGACA
ACGGCAAGTTCCAGTGCAGTAAATACTAATATTCCATCCCCTCTCATGGATCTTAATGACCTTATTTCTAACTTTGCAAAGAAAGGACTCAGTGCTAAAGAAATGGTGGCCCTCTCAG
GA
GCTCACACAATAGGACAAGCTAGGTGCTTATTGTTTCGACAAAGAATCTACAATGAAACAAACATTGATTCAGAATTTGCAACATCATTAAAATCAAACTGCCCAAGCTCAGGCGGCGAT
GACAACCTTTCTTCATTAGATGCCACCAGCCCT

Retrieve as FASTA