Entry information : CsPrx21 (orange1.1g041695m/Cs2g28810)
Entry ID 8878
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2016-02-02 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx21 (orange1.1g041695m/Cs2g28810)
Name (synonym) CsPrx21 (orange1.1g041695m/Cs2g28810)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx21
start..stop
S start..stop
CclPrx110 671 0 1..328 1..328
EgrPrx43 506 0 11..328 6..321
EcamPrx43 504 0 11..328 6..321
PnPrx90 503 0 4..328 3..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..219 219 N° 2 335..526 192 N° 3 1058..1223 166 N° 4 1480..1889 410
join(1..219,335..526,1058..1223,1480..1889)


exon

Literature and cross-references CsPrx21 (orange1.1g041695m/Cs2g28810)
DNA ref. Citrus sinensis Annotation Project:   chr2 (28386123..28388011) GenBank:   NC_023047.1 (28389181..28387293) Phytozome 12:   scaffold00028 (714309..712507)
Cluster/Prediction ref. Genebank:   102616075
Protein sequence: CsPrx21 (orange1.1g041695m/Cs2g28810)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (302)
PWM (Da):   %s   35124.69 (32231.1) Transmb domain:   %s   i7-26o
PI (pH):   %s   8.14 (7.70) Peptide Signal:   %s   cut: 27 range:27-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKISPKWSVHVFVILIVVLLCTSVNSQLQVGFYRNSCSSAELIVKDEVRKSVLKDKGVAAGLVRMHFHDCFVRGCDASVLIDSTSSNTAEKDSPVNNPSLRGFEVIDNAKAALESVCKGIVSCADIVAFAARDSVEISGGLGYDVPSGRRDGRISLASEALTNLPPPTFTVNQLTQSFANKGFTQEEMVTLSGAHTIGRSHCTSFSNRLYNFSGTMSQDPSLNPMYAAQLKQQCLQDGTNPNLVVPMNPGSPSIADTGYYIDILRNRGLFTSDQTLLSDPATASQVNQNAKTPKLWKTNFAAAMVKMGQIGVLTASAGEIRANCRVVN

Retrieve as FASTA  
Remarks Partial sequence from genomic (chromo 2, 3 introns). Incorrect prediction from Phytozome (Short 5' end is missing due to 'NNNNN' in DNA).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAATTAGTCCAAAGTGGTCCGTTCATGTTTTTGTTATTTTGATTGTGGTTTTGTTATGCACAAGTGTAAATTCTCAGCTTCAAGTAGGGTTTTATCGAAATTCATGTAGCTCAGCA
GAACTTATTGTGAAAGATGAGGTTAGAAAAAGTGTCCTTAAAGATAAAGGAGTGGCTGCTGGTCTTGTGAGAATGCATTTTCATGATTGCTTTGTTAGG
GTAATGTAAATATTAATTTAT
ATTTGCACTTACAAGTTTCTTTTTTTTTTTTTTTTGGATCATTTATATGACGCAATAAAGTAACTTAAAGATCTTCGTTGGTTCTGTTTATAAGGGTTGTGATGCATCAGTGCTGATCGA
CTCCACTTCTTCAAACACAGCCGAGAAAGACTCTCCTGTCAATAACCCTAGTCTGCGAGGGTTTGAAGTCATCGACAATGCAAAGGCTGCCCTAGAATCCGTTTGTAAAGGAATTGTATC
ATGTGCTGACATTGTTGCATTTGCGGCAAGGGACAGTGTGGAGATA
GTAAGCAGAGCTACATTTAATGTTTTGTCCTTCAGGACATTAATTAGCTAATTTTGGGTCCATTTGACTCAACT
ATTTAGTAAAACCACAGCTCTAAAATATTTAGGAAAAGAATTCCAATTTTACACTCATCTTGTCTTTGGCTAACCCTTTTGGATCCCCTTATTTGTGGATGATAAAATAAAAACAATAAA
ATGATAATTCTAAACCATATGTATATATTCGACTAATAATGTACAAGAGTTGCAAGATCTTTAAAAGGTAAGTGAAAGACAAGATGAAAAAATGATCCATTTCCTTGAACAACACTTACA
CATGTAGTTGAAAGTTGATTAGGTGATTTTAATTCATATTTGTTTGGTTTAAAAAAAAAACTTATGTTGTCTTTACTATTTTTGTTGAAAATATTATTTTCGATCATATTTATCAAACAT
TAATTAATTATCACCTTGTAATTTACCACAGCTGTGGCCTTTACACTACCAAACGATGCCTTAGTTTGCTTGATGCTATATAACATTTTGTTTGCAGAGTGGTGGGCTGGGCTATGATGT
TCCTTCAGGAAGAAGAGATGGCAGAATTTCACTAGCCTCTGAGGCATTAACCAATCTACCTCCCCCTACATTCACTGTCAACCAACTCACTCAATCCTTCGCAAACAAGGGCTTTACCCA
AGAAGAAATGGTTACACTTTCTG
GTAATTAATTATATAAATTTTCTAAATATAAATATTATCAGGTGCGTACGACGTCGGCATTATAAAATATCGGACACTTACTTTTACAACACTTTAA
ATCATTTATGATAATTTAAAGGTGTGTAAGTCTGCACTTTATAAAGTGCGGACATCCGCACCTAAGAATGACTCAAAGTTAAACATCTAGAAATGATTTATTATATAAATAAAATAAAAC
ATAATTTTAGTTAATGTAAAATCCATATAACATATACAGGAGCACACACCATTGGACGCTCTCACTGTACTTCCTTCAGTAACAGATTATACAATTTCAGTGGCACAATGAGTCAGGACC
CAAGCTTAAATCCCATGTATGCTGCTCAGTTGAAGCAGCAGTGCCTCCAAGACGGTACCAATCCGAACTTAGTGGTGCCAATGAATCCTGGGAGTCCAAGCATCGCTGACACTGGGTACT
ACATTGATATTTTGAGGAATCGTGGTTTGTTCACATCAGACCAAACTCTGTTGTCAGACCCAGCAACTGCAAGCCAAGTGAACCAAAATGCTAAAACTCCGAAACTTTGGAAGACAAATT
TTGCTGCTGCTATGGTGAAGATGGGCCAAATTGGTGTCTTAACGGCTAGTGCTGGCGAAATTCGAGCAAACTGTAGAGTTGTTAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAATTAGTCCAAAGTGGTCCGTTCATGTTTTTGTTATTTTGATTGTGGTTTTGTTATGCACAAGTGTAAATTCTCAGCTTCAAGTAGGGTTTTATCGAAATTCATGTAGCTCAGCA
GAACTTATTGTGAAAGATGAGGTTAGAAAAAGTGTCCTTAAAGATAAAGGAGTGGCTGCTGGTCTTGTGAGAATGCATTTTCATGATTGCTTTGTTAGG
GGTTGTGATGCATCAGTGCTG
ATCGACTCCACTTCTTCAAACACAGCCGAGAAAGACTCTCCTGTCAATAACCCTAGTCTGCGAGGGTTTGAAGTCATCGACAATGCAAAGGCTGCCCTAGAATCCGTTTGTAAAGGAATT
GTATCATGTGCTGACATTGTTGCATTTGCGGCAAGGGACAGTGTGGAGATA
AGTGGTGGGCTGGGCTATGATGTTCCTTCAGGAAGAAGAGATGGCAGAATTTCACTAGCCTCTGAGGCA
TTAACCAATCTACCTCCCCCTACATTCACTGTCAACCAACTCACTCAATCCTTCGCAAACAAGGGCTTTACCCAAGAAGAAATGGTTACACTTTCTG
GAGCACACACCATTGGACGCTCT
CACTGTACTTCCTTCAGTAACAGATTATACAATTTCAGTGGCACAATGAGTCAGGACCCAAGCTTAAATCCCATGTATGCTGCTCAGTTGAAGCAGCAGTGCCTCCAAGACGGTACCAAT
CCGAACTTAGTGGTGCCAATGAATCCTGGGAGTCCAAGCATCGCTGACACTGGGTACTACATTGATATTTTGAGGAATCGTGGTTTGTTCACATCAGACCAAACTCTGTTGTCAGACCCA
GCAACTGCAAGCCAAGTGAACCAAAATGCTAAAACTCCGAAACTTTGGAAGACAAATTTTGCTGCTGCTATGGTGAAGATGGGCCAAATTGGTGTCTTAACGGCTAGTGCTGGCGAAATT
CGAGCAAACTGTAGAGTTGTTAACTAG

Retrieve as FASTA