Entry information : SbPrxQ (Sobic.010G072900.1 [2.1] / Sb10g006380 [1.4])
Entry ID 888
Creation 2008-10-23 (Christophe Dunand)
Last sequence changes 2011-01-18 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-06 (Messaoudi)
Peroxidase information: SbPrxQ (Sobic.010G072900.1 [2.1] / Sb10g006380 [1.4])
Name (synonym) SbPrxQ (Sobic.010G072900.1 [2.1] / Sb10g006380 [1.4])
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Leaves
Inducers Methyl jasmonate treatment
Wounding
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrxQ
start..stop
S start..stop
ZmPrxQ 356 4e-127 1..212 1..218
TaPrxQ 350 6e-125 1..212 1..217
OsPrxQ 330 4e-117 1..212 1..217
LuPrxQ190 295 7e-103 31..212 30..211
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5863592..5863783 192 N° 2 5863868..5864005 138 N° 3 5864547..5864855 309  
join(5863592..5863783,5863868..5864005,5864547..5864855)


exon

Literature and cross-references SbPrxQ (Sobic.010G072900.1 [2.1] / Sb10g006380 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 11:   chromosome_10 (5863592..5864855)
EST ref. GenBank:   CN147676.1 [3' end]
Protein sequence: SbPrxQ (Sobic.010G072900.1 [2.1] / Sb10g006380 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   212
PWM (Da):   %s   22800.81  
PI (pH):   %s   10.25
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFTPATACCKPSLALAPRAASSRAQAAALLCTPSTSAFRGLRAAPAPPRWRRSAASTGIVCGKVSKGSVPPNFTLKDQNGKPVSLNKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDAASHKAFAQKYRLPFTLLSDEGNRVRKEWGVPADLFGTLPGRQTYVLDKQGVVQYIYNNQFQPEKHIGETLKILQSL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 10, 2 introns) and 1 EST. Cultivar="BTx623",
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTCACGCCCGCTACGGCCTGCTGCAAGCCTTCCCTGGCGCTGGCGCCGCGGGCGGCGTCGTCCCGCGCGCAGGCGGCGGCGCTCCTCTGCACGCCCTCCACCTCCGCGTTCCGC
GGCCTCCGGGCCGCGCCGGCCCCGCCGCGCTGGCGCCGCTCGGCGGCGTCCACGGGCATCGTCTGCGGCAAG
GTACGTGGCCTCGTAGCCATAGCCCCCGCGGAAATGGTTTTTTGGCTG
TGATTGGTTGATTTGATAGTCGTGGTTTGGTTGCAGGTCAGCAAGGGCAGCGTGCCACCAAACTTCACCCTCAAGGACCAGAACGGGAAGCCCGTGTCGCTGAACAAGTTCAAGGGCAAG
CCCGTCGTCGTCTACTTCTACCCCGCCGACGAGACGCCCGGATGCACAAAGCAG
GTCAGCTTCCTCCTTCCTGCGCAAATGCCTGAGCCGACACTTTACTGAAACGAACTCTGAAAACAT
GCATATGTTTTGTTGCCTCCAAGAAACAGCAAGAAACTCTGAAACCATGCGTCTGTTTTGTTTTGTTTTTTTGCCTCCAAAGAATAGCAAGAAGCTCTGAACCCATTCCAGTGCGGCGAG
TAATGCAGCGTAGTACTCGTATAATCATTTGTTTTGTTGCAAAGGCAAAAGCTTGTCAATTTGTAGAATGGAAGCAACCAATGGAAGATTGACCCAAAAGTAGCTGCATCTGAAAAGGCA
GCTTGTGGTTTCCATCCCTTTAGTTGACTTTTGACCTTTATTATATAGAAGAAGAAAAAGCTCAAAAGCAGCTCCCAAAAGCCCAGCCAAAATCACTCCTGAAACCGATGTATGCAAAGT
CGGCAAATTGCCTGAAATCAGCGTGTGTCTGTCTGTATCTGACCTCCACCACCACCACCAATCCTCTAATCTGCGCTAGTTGGTGCATGCAACACAATGCGAATGCGAATTGCAGGCGTG
CGCGTTCAGGGACTCGTACGAGAAGTTCAAGAAGGCCGGGGCGGAGGTGATCGGCATCAGCGGCGACGACGCGGCGTCGCACAAGGCGTTCGCGCAGAAGTACCGGCTGCCGTTCACGCT
GCTGAGCGACGAAGGGAACCGCGTGCGCAAGGAGTGGGGCGTCCCCGCCGACCTGTTCGGGACGCTCCCGGGGCGGCAGACGTACGTGCTGGACAAGCAGGGCGTCGTGCAGTACATCTA
CAACAACCAGTTCCAGCCCGAGAAGCACATCGGCGAGACGCTCAAGATCCTGCAGAGCCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTCACGCCCGCTACGGCCTGCTGCAAGCCTTCCCTGGCGCTGGCGCCGCGGGCGGCGTCGTCCCGCGCGCAGGCGGCGGCGCTCCTCTGCACGCCCTCCACCTCCGCGTTCCGC
GGCCTCCGGGCCGCGCCGGCCCCGCCGCGCTGGCGCCGCTCGGCGGCGTCCACGGGCATCGTCTGCGGCAAG
GTCAGCAAGGGCAGCGTGCCACCAAACTTCACCCTCAAGGACCAGAAC
GGGAAGCCCGTGTCGCTGAACAAGTTCAAGGGCAAGCCCGTCGTCGTCTACTTCTACCCCGCCGACGAGACGCCCGGATGCACAAAGCAG
GCGTGCGCGTTCAGGGACTCGTACGAGAAG
TTCAAGAAGGCCGGGGCGGAGGTGATCGGCATCAGCGGCGACGACGCGGCGTCGCACAAGGCGTTCGCGCAGAAGTACCGGCTGCCGTTCACGCTGCTGAGCGACGAAGGGAACCGCGTG
CGCAAGGAGTGGGGCGTCCCCGCCGACCTGTTCGGGACGCTCCCGGGGCGGCAGACGTACGTGCTGGACAAGCAGGGCGTCGTGCAGTACATCTACAACAACCAGTTCCAGCCCGAGAAG
CACATCGGCGAGACGCTCAAGATCCTGCAGAGCCTCTGA

Retrieve as FASTA