Entry information : CsPrx32 (orange1.1g043363m/Cs5g27410)
Entry ID 8881
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-05 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx32 (orange1.1g043363m/Cs5g27410)
Name (synonym) CsPrx32 (orange1.1g043363m/Cs5g27410)
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx32
start..stop
S start..stop
CclPrx90 742 0 1..371 1..371
MePrx102 423 3e-149 1..324 1..319
EcamPrx48 412 7e-145 21..321 21..319
MguPrx50 411 1e-144 4..324 3..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 817345..817548 204 N° 2 816007..816915 909  
complement(join(816007..816915,817345..817548))


exon

Literature and cross-references CsPrx32 (orange1.1g043363m/Cs5g27410)
DNA ref. Citrus sinensis Annotation Project:   chr5 (29995644..29997202) Phytozome 12:   scaffold00029 (817548..816007)
Protein sequence: CsPrx32 (orange1.1g043363m/Cs5g27410)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   371 (350)
PWM (Da):   %s   40631.84 (38151.5) Transmb domain:   %s   i7-24o
PI (pH):   %s   9.57 (9.15) Peptide Signal:   %s   cut: 22 range:22-371
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRTKGSFVLFFFFFIFPLALAQLRPGFYGTSCPRAESIVSDLVQKRFSADNSVTAALLRMHFHDCFVTGCDASILIDSTNQTQSEKESGANQTVREFELIDEIKKALEAECPSTVSCADIITLATRDAVTLAGGPRYTVLTGRRDGLRSNVDDVDLPGPQISVPDAQQVFQAKGLTSDEMVSLLGAHTVGFAHCSFFKDRLTNFQGTGLPDPTMNVTLIPKLRRICDAASTDNFGPKTFLDQSTNFVFDNKFHSEILSRRGILQIDQELGLDRSTAPMVSKFAFNSDEFLRSFASAMVNMGNIQVLVGNAGEIRQNCRAFNPLKAPTPSNPGNTPKPIPKPKPKPRPRPGKGGRKQKPPGKERKNKIPRIF

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAACCAAAGGCTCATTTGTTCTCTTTTTCTTCTTCTTCATCTTTCCGCTCGCGTTAGCTCAACTAAGGCCTGGTTTTTATGGCACAAGTTGCCCTAGAGCAGAATCAATTGTTTCC
GATTTGGTGCAAAAACGATTTAGTGCTGATAATTCCGTAACTGCAGCTCTGCTTCGTATGCATTTTCATGATTGCTTTGTTACA
GTAAGTAGTATTTCTATTTTTAACACTTAACTAGCT
AGTACTCATTATATCGATGCAAAAATTTGAAAATTCATTAAAGAATCTCCTCTAAAATTTATGAGAGAGTACGATGATGGGAGATTTTTTTTAATAACTTTTAATTTGAAAAAAGATATA
TTTTTTTAACAAATAACATATGGTAACTAATTTCTTCTATAACAATATTAGCAGATTTTGAATCCTAATCCCATCTAAAATATTTTATTGGTTGAACTGATTGACCCACTATAATTTCAT
ATTGGAACTATAAACTTATTTCAATAGTTTCAAAAATAAATAAATACACGATACGTGCTTACTTTTTCTTATATAATGAGTATTGTATTAGTTGACTGTATCTTCATTTTTCTTTTTCCA
CTAATTTGTACAATTCATTTTTGCTTGTTCTAGGGTTGTGATGCTTCCATTCTTATAGACTCAACAAACCAAACGCAATCAGAGAAAGAATCGGGAGCAAACCAAACAGTTCGAGAATTC
GAGCTCATTGATGAGATCAAGAAAGCCCTAGAGGCCGAATGCCCTTCAACCGTTTCATGTGCAGACATCATCACGCTCGCCACCCGCGACGCGGTGACACTAGCCGGAGGCCCCCGTTAC
ACCGTTCTCACAGGAAGAAGAGACGGTCTTCGATCAAACGTTGACGATGTCGACTTGCCAGGACCACAAATATCTGTGCCTGATGCCCAGCAAGTATTTCAAGCGAAAGGCCTGACGTCA
GACGAAATGGTAAGCCTTCTGGGAGCTCACACTGTTGGCTTTGCTCATTGTAGTTTCTTTAAGGACCGGCTGACAAACTTTCAAGGAACTGGGCTTCCTGATCCTACAATGAATGTTACT
TTGATCCCGAAGCTCAGAAGAATTTGCGATGCTGCGTCTACTGATAATTTTGGACCAAAAACGTTTTTGGACCAAAGCACAAATTTTGTGTTTGATAACAAGTTTCACAGCGAGATTCTT
TCACGTAGAGGGATACTTCAGATTGATCAGGAACTTGGTTTGGATAGATCTACAGCTCCAATGGTTTCTAAATTCGCGTTTAATTCGGATGAGTTTCTGAGGAGTTTTGCAAGTGCAATG
GTTAATATGGGAAACATACAAGTTCTTGTGGGAAATGCTGGAGAAATTAGACAAAATTGTAGAGCTTTCAATCCACTCAAAGCTCCGACACCATCAAATCCGGGCAACACCCCCAAACCG
ATACCAAAACCGAAGCCGAAACCGAGACCGAGACCAGGCAAGGGGGGAAGGAAACAGAAACCGCCAGGGAAGGAGAGAAAGAATAAGATACCAAGAATATTT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAACCAAAGGCTCATTTGTTCTCTTTTTCTTCTTCTTCATCTTTCCGCTCGCGTTAGCTCAACTAAGGCCTGGTTTTTATGGCACAAGTTGCCCTAGAGCAGAATCAATTGTTTCC
GATTTGGTGCAAAAACGATTTAGTGCTGATAATTCCGTAACTGCAGCTCTGCTTCGTATGCATTTTCATGATTGCTTTGTTACA
GGTTGTGATGCTTCCATTCTTATAGACTCAACAAAC
CAAACGCAATCAGAGAAAGAATCGGGAGCAAACCAAACAGTTCGAGAATTCGAGCTCATTGATGAGATCAAGAAAGCCCTAGAGGCCGAATGCCCTTCAACCGTTTCATGTGCAGACATC
ATCACGCTCGCCACCCGCGACGCGGTGACACTAGCCGGAGGCCCCCGTTACACCGTTCTCACAGGAAGAAGAGACGGTCTTCGATCAAACGTTGACGATGTCGACTTGCCAGGACCACAA
ATATCTGTGCCTGATGCCCAGCAAGTATTTCAAGCGAAAGGCCTGACGTCAGACGAAATGGTAAGCCTTCTGGGAGCTCACACTGTTGGCTTTGCTCATTGTAGTTTCTTTAAGGACCGG
CTGACAAACTTTCAAGGAACTGGGCTTCCTGATCCTACAATGAATGTTACTTTGATCCCGAAGCTCAGAAGAATTTGCGATGCTGCGTCTACTGATAATTTTGGACCAAAAACGTTTTTG
GACCAAAGCACAAATTTTGTGTTTGATAACAAGTTTCACAGCGAGATTCTTTCACGTAGAGGGATACTTCAGATTGATCAGGAACTTGGTTTGGATAGATCTACAGCTCCAATGGTTTCT
AAATTCGCGTTTAATTCGGATGAGTTTCTGAGGAGTTTTGCAAGTGCAATGGTTAATATGGGAAACATACAAGTTCTTGTGGGAAATGCTGGAGAAATTAGACAAAATTGTAGAGCTTTC
AATCCACTCAAAGCTCCGACACCATCAAATCCGGGCAACACCCCCAAACCGATACCAAAACCGAAGCCGAAACCGAGACCGAGACCAGGCAAGGGGGGAAGGAAACAGAAACCGCCAGGG
AAGGAGAGAAAGAATAAGATACCAAGAATATTT

Retrieve as FASTA