Entry information : CsPrx29 (orange1.1g045530m/Cs5g04960)
Entry ID 8887
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2016-02-02 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx29 (orange1.1g045530m/Cs5g04960)
Name (synonym) CsPrx29 (orange1.1g045530m/Cs5g04960)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx29
start..stop
S start..stop
CclPrx45 644 0 1..314 9..322
RcPrx09 553 0 1..314 9..321
PpePrx26 549 0 1..314 9..321
PtPrx78 541 0 1..314 9..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2225343..2225525 183 N° 2 2225653..2225832 180 N° 3 2226104..2226263 160 N° 4 2226370..2226791 422
join(2225343..2225525,2225653..2225832,2226104..2226263,2226370..2226791)


exon

Literature and cross-references CsPrx29 (orange1.1g045530m/Cs5g04960)
DNA ref. Citrus sinensis Annotation Project:   chr5 (2947472..2948792) Phytozome 11:   scaffold00005 (2225343..2226788)
Protein sequence: CsPrx29 (orange1.1g045530m/Cs5g04960)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   314
PWM (Da):   %s   33808.02  
PI (pH):   %s   6.66
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVILVMATSVQSQGGLKAGFYSSSCPGAEAIVRSTVESHFKKDPTVAAGLLRLHFHDCFVQGCDGSVLIAGSSAERSALPNLGLRGFEVIDDAKTQLEASCPGVVSCADILALAARDSVDLSDGPSWQVPTGRRDGRVSSSQGLNLPSPLDSVTVQRQKFAAKGLDDHDLVTLVGAHTIGQTDCQFFRYRLYNFTTTGNADPSISQSFLAQLQTLCPKDGDGTKRVALDIDSQNKFDVSFFKNVRDGKGVLESDQRLWEDAATRNIVQNYAGTIRGLLGFRFDFEFPKAMIKMSSIEVKTGSDGEIRKICSKFN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGATATTGGTAATGGCTACGTCAGTACAAAGCCAAGGAGGATTGAAAGCCGGGTTCTATTCTTCATCGTGCCCAGGGGCTGAGGCCATAGTTAGGTCAACTGTTGAATCACACTTT
AAGAAAGATCCCACCGTAGCGGCTGGCTTGCTGAGGCTTCATTTCCACGACTGCTTTGTTCAG
GTTGACTCTATTGGATGTCTTGAAATTGAAGAACAATTGTATATTGTTATTAGAGGT
TGCATGATATCATGCACGTATACTATATAAGCTAGCTTGGGGCGTAATTAATTCAAATTTGTTATTGCAGGGTTGCGATGGTTCAGTCTTGATAGCTGGGTCTTCTGCTGAGAGGAGTGC
GTTGCCTAACCTTGGCTTAAGAGGATTTGAAGTAATCGATGACGCAAAAACACAACTCGAGGCATCCTGTCCTGGTGTAGTCTCCTGTGCTGATATACTAGCACTTGCTGCTCGTGACTC
TGTGGACTTG
GTATGCTAACTTTGATCGGCTGATTTTTTTTTTAAGGATCTTATGCCATGCACTTATGCAATAACCACAGATCATGTTAGATATATGATATTCAATAACTACCAATCAAA
ATTAAAAACAAAAATAATAATAATAACTATGATTTTACGAAAAGATGAGCACAAATTAAGTTAAAATCAACACTGAACCCAAATACGATTTCTATATATCTGAATCTGAACTGGCGTGTT
TTTTGAAATGGGGACTTGTGCTGTGTGTTTTCACATGCAAGAGCGATGGACCAAGTTGGCAAGTGCCAACAGGAAGAAGAGATGGCAGAGTTTCATCATCGCAAGGTTTAAACTTACCTT
CTCCTCTCGATTCCGTTACCGTCCAGAGGCAAAAATTTGCTGCTAAAGGCCTTGATGATCATGATCTAGTGACCCTAGTTG
GTAACGCTCTGATATTATAATGTCTTTCTGTGTGTGTAT
ATGTGGTATCATAAATAAATCGTCAAGACAATTAATCTACTAAACGTATTAGATTTTATGGCCGCAGGGGCACATACAATTGGGCAAACAGACTGTCAATTCTTCCGATATCGTCTGTAC
AACTTCACAACAACAGGCAATGCGGATCCCAGCATTAGCCAGTCGTTCTTGGCACAACTGCAGACCCTTTGTCCCAAAGATGGTGACGGCACAAAACGTGTAGCACTAGATATAGATAGC
CAGAACAAATTTGATGTGAGCTTCTTCAAGAATGTACGTGATGGTAAAGGAGTTTTAGAGTCCGACCAAAGGCTGTGGGAAGATGCTGCGACACGCAATATCGTGCAAAACTATGCAGGC
ACCATTAGGGGGTTGCTTGGTTTTAGGTTTGATTTTGAATTTCCGAAAGCTATGATCAAAATGAGTAGCATCGAAGTGAAGACTGGCTCGGATGGGGAGATAAGAAAGATATGTTCGAAG
TTCAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGATATTGGTAATGGCTACGTCAGTACAAAGCCAAGGAGGATTGAAAGCCGGGTTCTATTCTTCATCGTGCCCAGGGGCTGAGGCCATAGTTAGGTCAACTGTTGAATCACACTTT
AAGAAAGATCCCACCGTAGCGGCTGGCTTGCTGAGGCTTCATTTCCACGACTGCTTTGTTCAG
GGTTGCGATGGTTCAGTCTTGATAGCTGGGTCTTCTGCTGAGAGGAGTGCGTTGCCT
AACCTTGGCTTAAGAGGATTTGAAGTAATCGATGACGCAAAAACACAACTCGAGGCATCCTGTCCTGGTGTAGTCTCCTGTGCTGATATACTAGCACTTGCTGCTCGTGACTCTGTGGAC
TTG
AGCGATGGACCAAGTTGGCAAGTGCCAACAGGAAGAAGAGATGGCAGAGTTTCATCATCGCAAGGTTTAAACTTACCTTCTCCTCTCGATTCCGTTACCGTCCAGAGGCAAAAATTT
GCTGCTAAAGGCCTTGATGATCATGATCTAGTGACCCTAGTTG
GGGCACATACAATTGGGCAAACAGACTGTCAATTCTTCCGATATCGTCTGTACAACTTCACAACAACAGGCAATGCG
GATCCCAGCATTAGCCAGTCGTTCTTGGCACAACTGCAGACCCTTTGTCCCAAAGATGGTGACGGCACAAAACGTGTAGCACTAGATATAGATAGCCAGAACAAATTTGATGTGAGCTTC
TTCAAGAATGTACGTGATGGTAAAGGAGTTTTAGAGTCCGACCAAAGGCTGTGGGAAGATGCTGCGACACGCAATATCGTGCAAAACTATGCAGGCACCATTAGGGGGTTGCTTGGTTTT
AGGTTTGATTTTGAATTTCCGAAAGCTATGATCAAAATGAGTAGCATCGAAGTGAAGACTGGCTCGGATGGGGAGATAAGAAAGATATGTTCGAAGTTCAATTAG

Retrieve as FASTA