Entry information : CsPrx28 (orange1.1g046044m/Cs4g03740)
Entry ID 8889
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-05 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx28 (orange1.1g046044m/Cs4g03740)
Name (synonym) CsPrx28 (orange1.1g046044m/Cs4g03740)
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx28
start..stop
S start..stop
CclPrx37 672 0 1..327 1..327
EgrPrx68 536 0 1..327 1..325
EglPrx68 536 0 1..327 1..325
EgrPrx67 536 0 1..327 1..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 51862..52074 213 N° 2 51556..51753 198 N° 3 50758..50923 166 N° 4 49957..50360 404
complement(join(49957..50360,50758..50923,51556..51753,51862..52074))


exon

Literature and cross-references CsPrx28 (orange1.1g046044m/Cs4g03740)
DNA ref. Citrus sinensis Annotation Project:   chr4 (2003484..2005803) Phytozome 11:   scaffold00050 (52074..49957)
Protein sequence: CsPrx28 (orange1.1g046044m/Cs4g03740)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (303)
PWM (Da):   %s   36267.38 (33707.1) Transmb domain:   %s   i5-24o
PI (pH):   %s   9.1 (9.11) Peptide Signal:   %s   cut: 25 range:25-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
METKSFFIILSSVVFSLIMTGASAQLREDFYRSTCPNVESLVRSAVTKKFTQTFVTAPATLRLFFHDCFVRGCDASVLLSSPNNRAEKDHPEDISLAGDGFDTVVKAKEAVDSDPQCRNKVSCADILALATRDVVSLAGGPFYKVELGRRDGRISTIASVQHKLPQPDFNLDQLNRMFSSHGLDQTDMIALSGAHTIGFSHCSRFSKRIYNFSPRNRIDPTLNFNYAMQLRGMCPVRVDPRIAIDMDPTTPRIFDNAYYKNLQQGKGLFTSDQILFSDGRSRDTVVRFASNKEAFNRAFISAITKLGRVGVKTGNQGEIRRDCALV

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAACTAAAAGCTTCTTCATTATTCTGTCATCTGTTGTTTTCTCTCTCATAATGACAGGTGCTTCTGCTCAACTTCGTGAAGACTTTTATAGAAGCACCTGCCCAAATGTAGAATCG
CTTGTACGCTCGGCAGTCACCAAGAAGTTCACTCAGACCTTTGTCACAGCCCCAGCAACTCTTAGACTCTTTTTCCACGATTGCTTTGTCCGG
GTAATCAGTGAGCCTATTTATTATCTA
AATCATATTGATTTTTAATGACGGTTAATGGCTGAGCTATATCTTGGATTTCTTCTTACATATGCTGTTTGTGCTTGATAGGGATGTGATGCTTCAGTGCTGCTATCGTCGCCGAATAAT
CGGGCAGAGAAGGATCACCCAGAAGATATATCACTAGCTGGAGATGGATTTGATACTGTGGTCAAAGCTAAGGAAGCTGTTGATAGTGATCCTCAGTGCAGAAACAAAGTTTCATGTGCT
GATATTTTAGCTCTTGCCACTAGAGATGTTGTTTCCTTG
GTATGCATTCTTTTCTCATTCACTAATTGTCCATTTGCATGTGGAGTTTTTAACAAATAAAATTTCTCTCTCACCTAAAAA
GAGTAGAATTAAAATATAAATGTATTTTTTTTTTTAAAAAAAAAAAGGTGAATGAGAGGTACATTAGACTTTTTCTCTTTGTTACTTAGATTCCACATGGAAAAAGGCTAAAAGAAAAAG
GTTAACCATTACTCATTATTATTGTTAAAAAATAATTTTGGGTGTTTTCGATGTCTACTCTTTTATTTATTGAATTTTATCATGTAATTATCTTTACATAATTACTTTTGACGTAGCATT
CCTTTTCTTATTGAACTTTTATTATGCATATAGTTTTTTGTTTTTTACATAATTGATTAATTGAGTATACAGCCACAGTATGAATCTAATAAATAAGAGAGTATATATGAAAAGCATCCA
CTGATTTGTTGGGTTAAATACTATGATCCCTCATTACATTTTCCCATTCAATAATTGAATAAATTATCTAAGACTACTCCAACTGCTACAATTCTATGATTGAGTCTTGAGAGTTTTCAT
ATTAGTTTATAACTTTATTATATTCATAATTATATGCTTTTGGTGACTAAAATACAAGAATATAAATGCAGGCAGGGGGACCATTCTATAAAGTTGAATTGGGGAGGCGTGATGGCAGAA
TATCGACAATAGCAAGTGTTCAGCACAAACTTCCTCAACCTGATTTTAATTTAGACCAACTCAACAGAATGTTCAGCTCACATGGTCTCGATCAAACGGACATGATTGCATTATCAG
GTA
TGTTTATATCTCCACTGAACTACCACTATGGAGAATGACTTTTCGTTCTTTGAGAATTCTTTATAAATTTTTAAAACCCCATTTCGTTCTTCGTTCTTGGCATTAAAATGTTGATTAAAA
GACAAAAACATATTGTTGAAAGTCAATGTAACTTTTTAATGAACACATATTAACTAGCTAGTTTTAATTTCTACGTTAAAATGTCATATTTATCTTTTATTTTGTTTGTTCACATTTCAA
TACAAGATGATAACTAGAACAAATGTTAAAAGTAATAAAATCTTAACCGTATATAGTGTTATATAAACATATATAAACACTTGAAAGTGTGAACTCAACTCAAAAGAAAATCTTTGACTC
TGGTGTAATATTGACTTACCCAACATTTTTTCAGGCGCGCATACGATAGGATTCTCTCACTGCAGCCGCTTCTCGAAAAGAATCTACAACTTCAGCCCCAGGAACAGAATCGATCCCACT
TTAAATTTCAATTATGCAATGCAGCTGAGGGGCATGTGCCCTGTAAGAGTTGATCCTAGAATTGCCATTGACATGGACCCTACGACGCCTCGAATTTTCGACAATGCTTACTACAAGAAT
CTTCAGCAGGGAAAGGGTTTGTTTACGTCTGATCAAATTTTGTTTTCTGATGGAAGATCAAGAGACACAGTTGTTCGATTTGCTTCCAACAAAGAAGCTTTTAATAGGGCCTTTATTTCT
GCTATTACAAAGCTTGGACGTGTGGGAGTCAAGACAGGAAATCAAGGAGAAATTCGAAGGGATTGCGCGCTTGTGAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAACTAAAAGCTTCTTCATTATTCTGTCATCTGTTGTTTTCTCTCTCATAATGACAGGTGCTTCTGCTCAACTTCGTGAAGACTTTTATAGAAGCACCTGCCCAAATGTAGAATCG
CTTGTACGCTCGGCAGTCACCAAGAAGTTCACTCAGACCTTTGTCACAGCCCCAGCAACTCTTAGACTCTTTTTCCACGATTGCTTTGTCCGG
GGATGTGATGCTTCAGTGCTGCTATCG
TCGCCGAATAATCGGGCAGAGAAGGATCACCCAGAAGATATATCACTAGCTGGAGATGGATTTGATACTGTGGTCAAAGCTAAGGAAGCTGTTGATAGTGATCCTCAGTGCAGAAACAAA
GTTTCATGTGCTGATATTTTAGCTCTTGCCACTAGAGATGTTGTTTCCTTG
GCAGGGGGACCATTCTATAAAGTTGAATTGGGGAGGCGTGATGGCAGAATATCGACAATAGCAAGTGTT
CAGCACAAACTTCCTCAACCTGATTTTAATTTAGACCAACTCAACAGAATGTTCAGCTCACATGGTCTCGATCAAACGGACATGATTGCATTATCAG
GCGCGCATACGATAGGATTCTCT
CACTGCAGCCGCTTCTCGAAAAGAATCTACAACTTCAGCCCCAGGAACAGAATCGATCCCACTTTAAATTTCAATTATGCAATGCAGCTGAGGGGCATGTGCCCTGTAAGAGTTGATCCT
AGAATTGCCATTGACATGGACCCTACGACGCCTCGAATTTTCGACAATGCTTACTACAAGAATCTTCAGCAGGGAAAGGGTTTGTTTACGTCTGATCAAATTTTGTTTTCTGATGGAAGA
TCAAGAGACACAGTTGTTCGATTTGCTTCCAACAAAGAAGCTTTTAATAGGGCCTTTATTTCTGCTATTACAAAGCTTGGACGTGTGGGAGTCAAGACAGGAAATCAAGGAGAAATTCGA
AGGGATTGCGCGCTTGTGAAC

Retrieve as FASTA