Entry information : CsPrx10 (orange1.1g020149m/Cs1g24640)
Entry ID 8906
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-11-30 (Qiang Li)
Peroxidase information: CsPrx10 (orange1.1g020149m/Cs1g24640)
Name (synonym) CsPrx10 (orange1.1g020149m/Cs1g24640)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx10
start..stop
S start..stop
CclPrx35 677 0 1..330 1..330
RcPrx17 603 0 1..330 1..330
PbPrx02 593 0 1..330 1..332
MePrx01 593 0 1..330 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 221245..221469 225 N° 2 221559..221750 192 N° 3 221836..222001 166 N° 4 222100..222509 410
join(221245..221469,221559..221750,221836..222001,222100..222509)


exon

Literature and cross-references CsPrx10 (orange1.1g020149m/Cs1g24640)
DNA ref. Citrus sinensis Annotation Project:   chr1 (26931325..26932865) Phytozome 12:   scaffold00017 (221245..222509)
Protein sequence: CsPrx10 (orange1.1g020149m/Cs1g24640)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (308)
PWM (Da):   %s   36221.17 (33662.9)  
PI (pH):   %s   8.48 (8.63) Peptide Signal:   %s   cut: 23 range:23-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAQLMIFLIAFSLLAFAPLCFCGKSSSGYLYPQFYDHSCPKAQEIVQCIVAKAVAKETRMAASLLRLHFHDCFVKGCDASILLDSSGSIISEKRSNPNRNSARGFEVIDEIKSALEKECPQTVSCADILALAARDSTVLTGGPSWEVPLGRRDSKGASLSGSNNDIPAPNNTFQTILTKFKLQGLDIVDLVALSGSHTIGNARCTSFRQRLYNQSGNGQPDNTLDESYAAQLRMGCPRSGGDQNLFFLDFVSPTKFDNSYFKNILASKGLLNSDQVLSTKNEASMELVKKYAENNDLFFQQFAKSMVKMGNISPLTGNRGEIRRNCRRIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCAGCTTATGATCTTTCTCATTGCTTTTTCTCTCCTTGCCTTTGCCCCTCTTTGCTTCTGTGGCAAGTCCTCCAGTGGTTACCTTTACCCACAGTTTTATGACCATTCCTGCCCA
AAAGCTCAAGAGATAGTGCAGTGCATTGTAGCCAAGGCTGTTGCAAAAGAAACCCGCATGGCTGCTTCATTGCTTAGACTCCATTTCCATGACTGTTTTGTCAAG
GTTAGCAACTTGACA
CAACATTCTTCCGATCACACTCCATTTAATTTTTAAGTAAAACCCCATTCCTTTTTTTTTTTTTTTGTGTGCAGGGTTGTGATGCATCAATATTACTAGACAGCAGTGGCAGTATAATTA
GTGAGAAGAGGTCGAATCCCAATAGGAACTCTGCAAGAGGATTTGAAGTCATTGATGAGATCAAGTCTGCTTTAGAGAAGGAGTGCCCTCAGACGGTTTCCTGTGCTGATATTTTGGCTC
TGGCTGCTAGAGATTCCACTGTTTTG
GTAAGTAGTGCTGTAACAATTAGTGCTTTGCCACAAGACCAAGATGGCCTTTCCCATCTAATCAAATCAAATTGTGCAACTGCAGACTGGTGGA
CCAAGCTGGGAGGTGCCATTGGGAAGAAGAGACTCCAAAGGTGCAAGCTTGAGTGGCTCAAACAACGACATTCCAGCTCCAAACAACACTTTCCAAACTATTCTAACCAAGTTCAAGTTG
CAAGGACTTGACATTGTCGATCTTGTAGCACTATCTG
GTAGTAATAACTGAAACTTGACTAGTTAATTTGTATATGTTATCACTGTTCAGAAACTAGGCATGTGTGTTAAAGCTTCTACA
ATTTATTTCATACAGGGAGCCACACAATCGGAAATGCTCGTTGCACTAGCTTCAGGCAGAGACTATACAACCAATCCGGCAACGGTCAACCAGACAACACTCTTGACGAATCATATGCTG
CCCAATTGCGAATGGGGTGCCCGAGATCCGGTGGTGACCAGAACTTATTTTTCTTGGACTTTGTCAGTCCAACGAAGTTTGATAACAGCTACTTCAAGAATATATTAGCTTCAAAGGGCC
TGTTGAACTCCGACCAAGTTCTCTCAACAAAGAACGAGGCATCAATGGAACTTGTGAAGAAATATGCCGAGAATAATGACCTTTTCTTTCAGCAATTTGCCAAGTCCATGGTTAAGATGG
GTAACATCTCTCCATTGACTGGTAACAGGGGAGAAATCAGAAGAAACTGCAGGAGGATTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCAGCTTATGATCTTTCTCATTGCTTTTTCTCTCCTTGCCTTTGCCCCTCTTTGCTTCTGTGGCAAGTCCTCCAGTGGTTACCTTTACCCACAGTTTTATGACCATTCCTGCCCA
AAAGCTCAAGAGATAGTGCAGTGCATTGTAGCCAAGGCTGTTGCAAAAGAAACCCGCATGGCTGCTTCATTGCTTAGACTCCATTTCCATGACTGTTTTGTCAAG
GGTTGTGATGCATCA
ATATTACTAGACAGCAGTGGCAGTATAATTAGTGAGAAGAGGTCGAATCCCAATAGGAACTCTGCAAGAGGATTTGAAGTCATTGATGAGATCAAGTCTGCTTTAGAGAAGGAGTGCCCT
CAGACGGTTTCCTGTGCTGATATTTTGGCTCTGGCTGCTAGAGATTCCACTGTTTTG
ACTGGTGGACCAAGCTGGGAGGTGCCATTGGGAAGAAGAGACTCCAAAGGTGCAAGCTTGAGT
GGCTCAAACAACGACATTCCAGCTCCAAACAACACTTTCCAAACTATTCTAACCAAGTTCAAGTTGCAAGGACTTGACATTGTCGATCTTGTAGCACTATCTG
GGAGCCACACAATCGGA
AATGCTCGTTGCACTAGCTTCAGGCAGAGACTATACAACCAATCCGGCAACGGTCAACCAGACAACACTCTTGACGAATCATATGCTGCCCAATTGCGAATGGGGTGCCCGAGATCCGGT
GGTGACCAGAACTTATTTTTCTTGGACTTTGTCAGTCCAACGAAGTTTGATAACAGCTACTTCAAGAATATATTAGCTTCAAAGGGCCTGTTGAACTCCGACCAAGTTCTCTCAACAAAG
AACGAGGCATCAATGGAACTTGTGAAGAAATATGCCGAGAATAATGACCTTTTCTTTCAGCAATTTGCCAAGTCCATGGTTAAGATGGGTAACATCTCTCCATTGACTGGTAACAGGGGA
GAAATCAGAAGAAACTGCAGGAGGATTAATTAA

Retrieve as FASTA