Entry information : CsPrx20 (orange1.1g020449m/Cs2g25450)
Entry ID 8908
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx20 (orange1.1g020449m/Cs2g25450)
Name (synonym) CsPrx20 (orange1.1g020449m/Cs2g25450)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx20
start..stop
S start..stop
CclPrx43 659 0 3..326 1..324
VvPrx65 529 0 13..326 9..322
PtPrx82 525 0 7..326 3..322
HaPrx08 521 0 7..326 7..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 692870..693085 216 N° 2 692255..692446 192 N° 3 691604..692176 573  
complement(join(691604..692176,692255..692446,692870..693085))


exon

Literature and cross-references CsPrx20 (orange1.1g020449m/Cs2g25450)
DNA ref. Citrus sinensis Annotation Project:   chr2 (24680776..24682614) Phytozome 11:   scaffold00038 (693085..691604)
Protein sequence: CsPrx20 (orange1.1g020449m/Cs2g25450)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (301)
PWM (Da):   %s   35385.42 (32342.0)  
PI (pH):   %s   4.73 (4.79) Peptide Signal:   %s   cut: 26 range:26-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEMGVMREMMVFLFTILLIMQRGDGQLVENFYSSTCPNVESIVNRVVSTKFSQTFITVPATLRLFFHDCFIVGCDASVLIQSPNGDAEKDAPDNLSLAGDGFDTVVQAKQAVEAQCPGVVSCADILAIAARDVVVLAGGAPFSVELGRRDGLVSRASSVKGNLPEPTFNLDELNQMFAKHGLSQIDMIALSGAHTLGFSHCDRFANRIYSFSSSSPVDPSLDPAYAQQLMQSCPRNVDPQIAINMDPVTPRTFDNMYYQNLVAGKGLFTSDQVLFTDASSQPTVNDFARNPLDFNAAFATAMRKLGRVGVKTGNQGEIRRDCTAFN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAATGGGAGTAATGAGAGAGATGATGGTGTTTTTGTTTACAATTCTTTTGATTATGCAGAGAGGCGATGGGCAATTGGTAGAAAATTTCTACTCGTCAACTTGTCCTAATGTTGAA
TCCATTGTGAACAGAGTGGTGTCAACAAAGTTTAGCCAAACGTTCATCACCGTTCCGGCAACTCTCCGGCTCTTTTTCCACGACTGCTTCATCGTG
GTAACTCATTATAACTAGCGTTTA
TCAAATACTAGATGATCATAAGGTTATATTTTCTGGTTTATAGCAGAAGCAATGTTGTTGTTGGNNNNNNNNNNNNNNNNNNNNNAGCAATTAATTTTTAGTAGACGGGTCGTTATTGGA
GGCTATCACACGTTATAGCTTAGACAAGAACAATTACCAAACCATTTTGACTTGAGAACATAATAGCGAATGGCTTAACATGGAGTTAACAGATTCAAGTACCACAAGCTTGGTCTGTAT
CATTTGACAACTCATAGTACAATATAAAGTGGTGGCATGGAAAGAAGAATAGAAAGATGCACACACGTGTTTGACTAGGGTGGCATCTCTTATGGCTTAGGCTACTGTGATAATTAGCGT
GGATTACAATAATTGGCAACTGAGTTGTTTCTTTGACAGGGATGTGATGCCTCGGTCCTGATTCAATCGCCAAATGGGGACGCGGAGAAGGATGCCCCAGACAACCTTTCCCTTGCAGGA
GACGGATTTGACACTGTTGTTCAGGCTAAGCAAGCTGTGGAAGCACAGTGCCCCGGCGTAGTCTCTTGCGCAGACATCTTAGCTATTGCTGCAAGGGATGTTGTAGTCCTG
GTAATTAGC
ATCATTATTAACTAGCAACCACAATGTTTCCCACTTTGTGAAGTTAAATTTAGTCCGATCAATATGCAGGCTGGAGGTGCTCCATTCAGCGTAGAATTGGGAAGACGCGATGGCCTTGTA
TCTAGAGCCTCAAGTGTGAAGGGAAATTTGCCAGAACCAACATTCAATCTTGATGAACTCAACCAAATGTTTGCCAAACACGGCCTCAGCCAAATTGACATGATTGCACTCTCAGGAGCT
CACACTTTAGGCTTCTCTCATTGCGACCGCTTTGCAAACCGCATCTACTCATTCTCTTCATCATCTCCTGTCGATCCTTCATTGGATCCAGCTTATGCCCAGCAGTTAATGCAATCCTGT
CCGCGAAATGTTGACCCCCAAATTGCCATCAACATGGATCCTGTAACCCCACGAACATTTGACAATATGTACTACCAGAATCTAGTGGCGGGGAAGGGCTTGTTTACTTCGGATCAAGTG
CTATTCACTGATGCATCATCTCAGCCTACTGTGAATGACTTTGCTAGAAACCCTCTTGACTTTAATGCAGCATTTGCCACAGCTATGAGAAAGCTTGGCAGAGTTGGGGTTAAAACCGGT
AACCAAGGAGAAATACGAAGAGACTGCACAGCATTTAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAATGGGAGTAATGAGAGAGATGATGGTGTTTTTGTTTACAATTCTTTTGATTATGCAGAGAGGCGATGGGCAATTGGTAGAAAATTTCTACTCGTCAACTTGTCCTAATGTTGAA
TCCATTGTGAACAGAGTGGTGTCAACAAAGTTTAGCCAAACGTTCATCACCGTTCCGGCAACTCTCCGGCTCTTTTTCCACGACTGCTTCATCGTG
GGATGTGATGCCTCGGTCCTGATT
CAATCGCCAAATGGGGACGCGGAGAAGGATGCCCCAGACAACCTTTCCCTTGCAGGAGACGGATTTGACACTGTTGTTCAGGCTAAGCAAGCTGTGGAAGCACAGTGCCCCGGCGTAGTC
TCTTGCGCAGACATCTTAGCTATTGCTGCAAGGGATGTTGTAGTCCTG
GCTGGAGGTGCTCCATTCAGCGTAGAATTGGGAAGACGCGATGGCCTTGTATCTAGAGCCTCAAGTGTGAAG
GGAAATTTGCCAGAACCAACATTCAATCTTGATGAACTCAACCAAATGTTTGCCAAACACGGCCTCAGCCAAATTGACATGATTGCACTCTCAGGAGCTCACACTTTAGGCTTCTCTCAT
TGCGACCGCTTTGCAAACCGCATCTACTCATTCTCTTCATCATCTCCTGTCGATCCTTCATTGGATCCAGCTTATGCCCAGCAGTTAATGCAATCCTGTCCGCGAAATGTTGACCCCCAA
ATTGCCATCAACATGGATCCTGTAACCCCACGAACATTTGACAATATGTACTACCAGAATCTAGTGGCGGGGAAGGGCTTGTTTACTTCGGATCAAGTGCTATTCACTGATGCATCATCT
CAGCCTACTGTGAATGACTTTGCTAGAAACCCTCTTGACTTTAATGCAGCATTTGCCACAGCTATGAGAAAGCTTGGCAGAGTTGGGGTTAAAACCGGTAACCAAGGAGAAATACGAAGA
GACTGCACAGCATTTAATTAG

Retrieve as FASTA