Entry information : SbPrx14 (Sobic.001G328100.1[2.1]Sb01g031740[1.4])
Entry ID 891
Creation 2008-10-19 (Christophe Dunand)
Last sequence changes 2008-10-19 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-01 (Messaoudi)
Peroxidase information: SbPrx14 (Sobic.001G328100.1[2.1]Sb01g031740[1.4])
Name (synonym) SbPrx14 (Sobic.001G328100.1[2.1]Sb01g031740[1.4])
Class Class III peroxidase    [Orthogroup: Prx115]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Seedlings
Inducer Dark growth
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx14
start..stop
S start..stop
ZmPrx41 570 0 1..344 3..349
ZmPrx55 564 0 1..344 3..342
SiPrx157 543 0 45..344 32..330
OsPrx4849 489 6e-176 29..344 1..313
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 54429209..54429487 279 N° 2 54428754..54428945 192 N° 3 54428202..54428367 166 N° 4 54426059..54426456 398
complement(join(54426059..54426456,54428202..54428367,54428754..54428945,5442920 9..54429487))


exon

Literature and cross-references SbPrx14 (Sobic.001G328100.1[2.1]Sb01g031740[1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_1 (54429487..54426059)
EST ref. GenBank:   BE355525.1 [3' end]
Protein sequence: SbPrx14 (Sobic.001G328100.1[2.1]Sb01g031740[1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   344
PWM (Da):   %s   35487.54  
PI (pH):   %s   4.81
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTPLDCDMPPAASCKKRLSPSRPLPNRCLLILIVALAAAAAVASAQLSSEDYYDASCPAALFTIRTAVSTAVLLDRRMGASLLRLHFHDCFVQGCDASVLLDDTASFTGEKGAGPNAGSLRGFDVIDNIKMLLELLCPQTVSCADILAVAARDSVAQLGGPSWSVPLGRRDATTASASLANSDLPGPTSNLNGLLNAFSNKGLSSTDMVALSGAHTVGRAQCKNIRSRIYNDTDIDATYAASLRASCPAQAGGASDGALEPLDDATPDAFDNAYFGNLLSQRGLLHSDQALFGGGGATDGLVSTYASSADQWGSDFAAAMVKMGNISPLTGTDGEIRVNCRRVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns) and 3 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACACCCCTCGACTGCGACATGCCTCCTGCAGCTTCCTGCAAGAAGCGCCTCTCGCCGTCGCGGCCTCTCCCTAACCGCTGCTTGCTGATCTTGATCGTTGCACTGGCGGCCGCCGCC
GCGGTGGCCAGCGCGCAGCTGTCGTCGGAGGACTACTACGACGCCTCCTGCCCCGCCGCCCTCTTCACCATCCGGACCGCCGTCTCGACGGCCGTGCTCCTGGACCGCCGCATGGGGGCC
TCCCTTCTCCGCCTCCACTTCCACGACTGCTTCGTGCAG
GTAATTAAGTCAGCGATCTCCCATATATCTGTCACCGGTTCGTCGTCTCTCCTGCGGTCGTCCTAGCTGCTAGATGAAGTT
CATGATAAGTGTGGATTACTAGCTAGTAGCTAGCTGAGTGATCAGAAATCTCGGCCTTGTTCGTTTGAGCTTTATCTGTTGAATCTCACAAAAAAATCAACAAACAGTAGTACTTTCAAC
TATTGTTGTTCATCTCTACGGCTTTGTTTGTATATGCACGTACGTACGGCCGGGCGGCACAGGGTTGTGACGCGTCGGTGCTGCTAGACGACACGGCGAGCTTCACCGGCGAGAAGGGGG
CGGGGCCGAACGCGGGGTCGCTTCGCGGCTTCGACGTGATCGACAACATCAAGATGCTGCTGGAGCTGCTGTGCCCGCAGACCGTCTCCTGCGCCGACATCCTTGCCGTCGCCGCCCGCG
ACTCCGTTGCACAA
GTAAGCCACACCTCTCGATGGATCCATCAACTGTGTAAATGAAGGCACACACGCACACCTCTGTAATTTGGCCTACACTGTTTTACATTATTCCACTGAATTGATT
TAGATAAATTCTGTTTTACTTGCACATAATTAATTGATGAGTCGGAAAATATGATCGAGCATGAATCTGTCTCAGCAGCCTGTATATAACAGAACTGAACAGACACAGATGATGCTCTCC
GATCGATCGACCCACTTTATTTCCCACACGTCAAAAGTAGAAATATGAAATGCATGATTAGTTTATATCATATCATAGCAAAGGTCGAGCAGGCTAGCTTAAAAGTGATTCTCTGAAAAG
AGAGGACGAAAAAGTTGATTTGATCAGCGTGTTGATGCAGCTGGGAGGACCATCGTGGTCGGTTCCCTTGGGCAGGAGGGACGCCACCACGGCGAGCGCGTCCCTGGCCAACAGCGACCT
GCCCGGACCTACCAGCAACCTCAACGGCCTTCTCAACGCTTTCTCCAACAAGGGTTTGAGCAGCACCGACATGGTTGCCCTCTCAG
GTACTTCACATGCATGCATGCACGAGCGAGGTAG
CTAGGATCGATGATGCATCATTGACACATGTTACATGACTGAAGATTGAAATCGGGCCGACCTCCTTTTTCTCTGCTTCATGCAATGCATAGTACATATATAGCTAGATTCATTCGCAGC
AGGCAGACTAAGATGGCGGATGGCACGTCCCATCATAGATCTTTGCTTTGCTTCACACTGCATTCGATCGGCAGTGCAGCTGATCAGCCACAGCTAGCTAGCTCGAGCACATGGTATGTC
CTGCTAGTAAAAATAAACTAAAATGCATGAACAGGCAATTGATATCGACGCGGCACCCATTCGTCATTCCAGGCCAGGCACCGTGCGACCAAATGACTATTCTGCAGACGTACGTCGATA
TAATATCGAGGAAGAATGAAATTATTTCTTCATGTTTGAATTCAAATTAAGGTAGTTATGCCTTATATATACTAGGACATAGTGAGTAGCTAGCTACTACGCACTGTGTATGTACTCTTA
GCACCTGAACGGCTATATAGTCTTGTGCACTAGTGAGGCCTTATTTAGTCCCGAAAAGATTTCGGATTTCGGCACTGTAGCATTTTCGTTTTTATTTGACAAATATTATCCAATCATGGA
CTAACAAGTCTCAAAAGATTCATCTCGTGATTTACAGGCAAACTGTGCAATTAGTTTTTATTTTCATCTATATCTAATGCTTTATGCATGTGCTCTAAGATTTGATGTGACGGGGAATCT
TAAAAAAAATTAGTTTTTAGAATGAACTAAACAAGGCATGAATAACGGAGTCAGAATACAATTGTTCCATCTAAAAACAACTCTCAACGTATCAAGTACGTCCCGCTAGGTACGTGCACA
CGCACGCATGAATACGAGGCCTTGTTTAGTTCACCTTAAAAATAAATTTTTTTCAAGATTTTCCGTCACATCGAATCTTGCAGCACATGCATGACGAACTAAATATAGACGAAAATAAAA
CTAATTGCATACTGTAAATTGTGAGATTAATCTTTTAAGTCTAGTTACTTTATAATTAGATAATATTTATCAAATAAAACAAAAATGCTATAATCATGAAAATAAAAAAAAATTCGAAAC
TAAACAAGGCCCCAGTATTTTGTGCCCTGTTCTGTTTTCCTTTACTCGGTAGCCATTGTCTGCTTCACATCTCGACTTCATATGATTCCGCATGCAGTGCACATCATCTATATGCATATT
TAATATATGCATACATCGTACTAGCAAGGAAAACGCTAGCTACATGCATGATGCATCATTGTTCGTTTGCATGCGCGTATCAGTTCAACATGGTGATGGACGACGACACGACGTCCTGTT
GGTCTCTGTTCAAGCTAAAGTCACCACCTTTTTGCTCGCAACCTGACAACATTTGGACGCGTAGGCGTCACCTACCGAGTACTACGTGCATGATCATCGATCAGACGATCACAGCATCAC
GCGATCGACAGACCAACTACCAGCTGCTTCTACCACCATGCCTGCAGCAATCATGCATGCATGCATGCGACAGCAGAGCAAGATTTCCATCTCCATGCATGATTGCGTTGCGTGTCTCCA
CCGCCCACGGAGCCATTTTTTCCCTCTGTCATCCATCAGATTTGCATTGAAACAAACATATATCTAAATATAGTTTTGTATGTATGTTTGCACATTTTTCAATACGGATCTAATAAGGCA
AAATAAAATTTACCCTCGTCACGCGTTGCAGGTGCCCACACCGTCGGCCGGGCGCAGTGCAAGAACATCCGGTCGCGGATCTACAACGACACCGACATTGACGCCACCTACGCGGCGTCG
CTGCGGGCAAGCTGCCCCGCGCAGGCCGGCGGCGCCAGCGACGGCGCGCTCGAGCCGCTCGACGACGCCACGCCGGACGCCTTCGACAACGCCTACTTCGGCAACCTGCTCTCCCAGCGC
GGCCTGCTCCACTCCGACCAGGCGCTCTTCGGCGGCGGCGGCGCGACGGACGGCCTGGTCAGCACCTACGCGTCCAGCGCCGACCAGTGGGGGAGCGACTTCGCCGCGGCCATGGTCAAG
ATGGGCAACATTAGCCCGCTCACCGGCACCGACGGCGAGATCAGGGTCAACTGCCGGAGAGTGAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACACCCCTCGACTGCGACATGCCTCCTGCAGCTTCCTGCAAGAAGCGCCTCTCGCCGTCGCGGCCTCTCCCTAACCGCTGCTTGCTGATCTTGATCGTTGCACTGGCGGCCGCCGCC
GCGGTGGCCAGCGCGCAGCTGTCGTCGGAGGACTACTACGACGCCTCCTGCCCCGCCGCCCTCTTCACCATCCGGACCGCCGTCTCGACGGCCGTGCTCCTGGACCGCCGCATGGGGGCC
TCCCTTCTCCGCCTCCACTTCCACGACTGCTTCGTGCAG
GGTTGTGACGCGTCGGTGCTGCTAGACGACACGGCGAGCTTCACCGGCGAGAAGGGGGCGGGGCCGAACGCGGGGTCGCTT
CGCGGCTTCGACGTGATCGACAACATCAAGATGCTGCTGGAGCTGCTGTGCCCGCAGACCGTCTCCTGCGCCGACATCCTTGCCGTCGCCGCCCGCGACTCCGTTGCACAA
CTGGGAGGA
CCATCGTGGTCGGTTCCCTTGGGCAGGAGGGACGCCACCACGGCGAGCGCGTCCCTGGCCAACAGCGACCTGCCCGGACCTACCAGCAACCTCAACGGCCTTCTCAACGCTTTCTCCAAC
AAGGGTTTGAGCAGCACCGACATGGTTGCCCTCTCAG
GTGCCCACACCGTCGGCCGGGCGCAGTGCAAGAACATCCGGTCGCGGATCTACAACGACACCGACATTGACGCCACCTACGCG
GCGTCGCTGCGGGCAAGCTGCCCCGCGCAGGCCGGCGGCGCCAGCGACGGCGCGCTCGAGCCGCTCGACGACGCCACGCCGGACGCCTTCGACAACGCCTACTTCGGCAACCTGCTCTCC
CAGCGCGGCCTGCTCCACTCCGACCAGGCGCTCTTCGGCGGCGGCGGCGCGACGGACGGCCTGGTCAGCACCTACGCGTCCAGCGCCGACCAGTGGGGGAGCGACTTCGCCGCGGCCATG
GTCAAGATGGGCAACATTAGCCCGCTCACCGGCACCGACGGCGAGATCAGGGTCAACTGCCGGAGAGTGAATTAA

Retrieve as FASTA