Entry information : CsPrx47 (orange1.1g020635m/Cs9g05140)
Entry ID 8912
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx47 (orange1.1g020635m/Cs9g05140)
Name (synonym) CsPrx47 (orange1.1g020635m/Cs9g05140)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx47
start..stop
S start..stop
CclPrx46 656 0 1..323 1..322
CsPrx46 509 0 1..323 1..323
CclPrx83 508 0 1..323 1..323
MePrx88 476 5e-171 7..323 2..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1848767..1848976 210 N° 2 1849349..1849540 192 N° 3 1849955..1850120 166 N° 4 1850426..1850829 404
join(1848767..1848976,1849349..1849540,1849955..1850120,1850426..1850829)


exon

Literature and cross-references CsPrx47 (orange1.1g020635m/Cs9g05140)
DNA ref. Citrus sinensis Annotation Project:   chr9 (3002093..3004078) Phytozome 12:   scaffold00011 (1848767..1850829)
Protein sequence: CsPrx47 (orange1.1g020635m/Cs9g05140)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (308)
PWM (Da):   %s   35526.9 (33834.0)  
PI (pH):   %s   7.38 (7.05) Peptide Signal:   %s   cut: 23 range:16-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKASSIFFLISLVAALGACSTGGELRKNFYEETCPEAENIVHNIVWKNAALNPTLAAKLLRVHFHDCFVRGCDASVLIDSTESNSGEKDALPNETLGGFDVIEEVKTELEKKCPGIVSCADIVALAARDSVSFQFKRTLWEVLTGRRDGRISLASEANRDMPSPFFNFSSLQQSFENNGLTVHDLVVLSGGHTLGVGRCRFFRDRLYNFTGKGDADPSLNPTYAAFLRTKCRNVEDNKTAVGMDPGSDLSFDTNYFKILTQHKGLFQSDAALLTDKGARNFVNVLLDSKRFFMEFGLSMKRMGAIGVLTGNSGEIRKKCNVIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGCTAGCTCAATTTTCTTCTTGATCTCTTTGGTAGCAGCTTTAGGAGCTTGCAGTACTGGAGGGGAATTGAGGAAAAATTTTTACGAGGAAACTTGCCCCGAGGCTGAAAACATT
GTGCACAATATCGTTTGGAAAAATGCTGCACTCAATCCAACTTTGGCAGCAAAATTACTTAGAGTGCATTTCCACGATTGTTTTGTTAGG
GTAACAATTAATAACACATGTCATCTTCAT
TTATTATTAGTCATAGCCATTTTCATAGTGATAATTAGAAATTTTTATTCACCCTAAAGATATTTTGCAAACATTATTTGTTCTTTTCAATACCAGCACGTCAGCATATTGTTACGGGCT
GCTAAAATTTACCTTAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATACATATATAAATTTGTTTTAAATGAAAGCTCTGGTCCGAAG
AGAAGTCACATTCTTTTTAAATACGAAGAAATAAAAAACATGTATCACAAATGCATGCTTTACAAGATTAATAAGCTTGTGATTTGATTGATTTTGTCTTAGGGTTGCGATGCCTCGGTA
TTGATAGACTCAACAGAAAGCAACTCAGGGGAAAAGGATGCACTTCCGAACGAAACCCTTGGAGGATTTGATGTTATAGAAGAAGTCAAAACTGAGCTTGAGAAGAAATGCCCCGGAATT
GTTTCATGTGCTGATATTGTAGCTCTCGCTGCTAGAGACTCCGTTTCCTTCCAA
GTAAGTTCTAAATTAAATTAACTATTTAAAAAGGAAAAAGAAAAAAAACACTTTCTCATGCCGCTA
TATTGTGGTGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATTATATGCTGCAGTTTAAGAGGACA
TTGTGGGAAGTGCTTACAGGAAGAAGAGACGGTAGAATTTCGCTTGCTTCGGAAGCGAATAGGGATATGCCTTCCCCCTTCTTCAACTTCAGTAGTCTCCAACAATCTTTTGAAAACAAC
GGCCTTACTGTTCATGACCTAGTCGTTTTATCAG
GTAACGATAAAGAAATTAAAAGCAATTAACCAAACCACATTTTTATCGTTAAAAGTTAATTACAGTCAAAATTTTGATATGAAGCT
ACTAGTTAGTTAATGATTTATTAGGTGTATATATATAGGCTATCGGATGGCTTTCTAAAACTTTGAATTTTACTTGTATGGGATTGTAATCGACAAATTTCAACTAAAAGAAATTCGGAG
AACAGCCTTTGGCTTCCTCCTTAGCGAAAATAATTTCTTGAATAAAATTGATCTCAAAATAGTTATAAATTTAGAGTGCATTGGCTATGACATGGGCAGGTGGACATACTCTTGGAGTTG
GTCGTTGCAGATTCTTCCGCGACAGGCTGTACAATTTCACCGGAAAAGGTGATGCAGATCCATCATTGAACCCTACTTATGCTGCATTCTTGAGAACCAAATGCAGAAACGTAGAAGATA
ACAAAACTGCAGTGGGAATGGACCCCGGCAGCGACTTGTCTTTTGATACCAATTACTTCAAAATCCTGACGCAACATAAAGGACTGTTCCAATCTGATGCTGCACTTTTAACTGACAAGG
GTGCCAGAAACTTTGTCAATGTGTTGCTCGATTCGAAAAGGTTTTTCATGGAGTTTGGTCTGTCCATGAAGAGAATGGGAGCCATTGGAGTTCTTACGGGTAATTCAGGAGAGATCAGAA
AGAAGTGCAATGTGATCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGCTAGCTCAATTTTCTTCTTGATCTCTTTGGTAGCAGCTTTAGGAGCTTGCAGTACTGGAGGGGAATTGAGGAAAAATTTTTACGAGGAAACTTGCCCCGAGGCTGAAAACATT
GTGCACAATATCGTTTGGAAAAATGCTGCACTCAATCCAACTTTGGCAGCAAAATTACTTAGAGTGCATTTCCACGATTGTTTTGTTAGG
GGTTGCGATGCCTCGGTATTGATAGACTCA
ACAGAAAGCAACTCAGGGGAAAAGGATGCACTTCCGAACGAAACCCTTGGAGGATTTGATGTTATAGAAGAAGTCAAAACTGAGCTTGAGAAGAAATGCCCCGGAATTGTTTCATGTGCT
GATATTGTAGCTCTCGCTGCTAGAGACTCCGTTTCCTTCCAA
TTTAAGAGGACATTGTGGGAAGTGCTTACAGGAAGAAGAGACGGTAGAATTTCGCTTGCTTCGGAAGCGAATAGGGAT
ATGCCTTCCCCCTTCTTCAACTTCAGTAGTCTCCAACAATCTTTTGAAAACAACGGCCTTACTGTTCATGACCTAGTCGTTTTATCAG
GTGGACATACTCTTGGAGTTGGTCGTTGCAGA
TTCTTCCGCGACAGGCTGTACAATTTCACCGGAAAAGGTGATGCAGATCCATCATTGAACCCTACTTATGCTGCATTCTTGAGAACCAAATGCAGAAACGTAGAAGATAACAAAACTGCA
GTGGGAATGGACCCCGGCAGCGACTTGTCTTTTGATACCAATTACTTCAAAATCCTGACGCAACATAAAGGACTGTTCCAATCTGATGCTGCACTTTTAACTGACAAGGGTGCCAGAAAC
TTTGTCAATGTGTTGCTCGATTCGAAAAGGTTTTTCATGGAGTTTGGTCTGTCCATGAAGAGAATGGGAGCCATTGGAGTTCTTACGGGTAATTCAGGAGAGATCAGAAAGAAGTGCAAT
GTGATCAATTAA

Retrieve as FASTA