Entry information : CsPrx18 (orange1.1g020966m/Cs2g15310)
Entry ID 8915
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx18 (orange1.1g020966m/Cs2g15310)
Name (synonym) CsPrx18 (orange1.1g020966m/Cs2g15310)
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx18
start..stop
S start..stop
CclPrx49 648 0 1..319 1..319
PatrPrx01 517 0 8..319 6..316
PtPrx53 513 0 8..319 6..316
EcamPrx191 507 0 1..319 1..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 395790..396008 219 N° 2 396283..396474 192 N° 3 396642..397190 549  
join(395790..396008,396283..396474,396642..397190)


exon

Literature and cross-references CsPrx18 (orange1.1g020966m/Cs2g15310)
DNA ref. Citrus sinensis Annotation Project:   chr2 (12078781..12080573) Phytozome 12:   scaffold00041 (395790..397190)
Protein sequence: CsPrx18 (orange1.1g020966m/Cs2g15310)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (293)
PWM (Da):   %s   34056.97 (31216.5) Transmb domain:   %s   i5-27o
PI (pH):   %s   8.65 (8.76) Peptide Signal:   %s   cut: 27 range:27-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSISYLFVTLILTIISLLACTSNAQLSPTFYATSCPNFQRIARDEMTKAVNRQPRNAASILRLFFHDCFVNGCDGSVLLDDTATFTGEKNAGPNRNSARGFEVIDAIKTRLEAACNATVSCADILAVAARDGVALLGGPTWTVPLGRRDARTASQSAANSQIPGPSSSLATLISMFAAKGLTAQDMTVLSGGHAIGFARCAAFRNRIYNDTNIDPAFATTRRTTCPATGGDPNLAPLDQTPNRFDNSYYQNLVNRRGLLHSDQELFNGGSQDATVRGYSTNPASFARDFAAAMVKMGNISPLTGTNGEIRRNCRVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCTTCAATTTCTTATTTGTTTGTTACACTTATACTCACAATTATATCCCTTCTAGCTTGCACCTCCAATGCGCAACTTTCTCCAACCTTTTATGCAACATCTTGCCCCAATTTT
CAAAGAATCGCGAGGGATGAAATGACCAAAGCTGTTAATAGACAACCGCGTAATGCTGCCTCTATTCTTCGCCTCTTCTTCCATGACTGCTTCGTTAAT
GTACGTTTTTGCTAGTGTGTG
TGTGTGTATGTACAGTGGTGATCTAATCTAAGATTCTAAACTTTATTAAAATTTAAAATAAATTGACATACTTTTATTTTTCATGTTCTAGAAGTATAAATATGTTCACATTAGAGTCAA
CTTGTCCTGAATTTTAATCTCCGGATTAGAAAATTATATATATATTGTTTCTAATTTTATCATGATTTGGGAGTTACATATTTTATGTTTATATATATATATATTATTATTTTATTTTAT
TTTGGTTTTTTAGGGCTGCGATGGGTCGGTACTACTAGATGACACAGCCACATTCACCGGCGAGAAGAATGCAGGACCAAACAGAAACTCTGCTAGGGGTTTTGAAGTGATTGACGCCAT
TAAAACTCGTCTGGAAGCAGCTTGCAACGCCACCGTTTCATGTGCCGACATCCTTGCTGTTGCAGCCCGAGACGGTGTCGCCTTG
GTCAGTCATTGCTTGCTTTTTGTTGAAATATTAAT
AGCACAGTTTAATTTTGCATGCAAGTATATGTGTGTGTGTGTTTACTGCAATGGTTTTGCTTTTGAAAAAAAATTAATAATAATCATTCATATTTCAATGTATTNNNNNNNNNNNNNNNN
NNNNNNNNNNAGCTTGGAGGACCGACTTGGACGGTACCGCTCGGCCGGCGAGATGCAAGAACGGCCAGTCAGAGTGCAGCCAATAGCCAAATCCCTGGACCATCCTCCAGCCTGGCAACA
CTCATATCAATGTTTGCAGCCAAAGGCCTGACCGCCCAAGACATGACAGTCCTCTCCGGCGGCCACGCCATCGGATTCGCTCGATGCGCCGCCTTCCGGAACCGCATATACAACGACACC
AACATTGACCCAGCTTTTGCAACCACCAGAAGAACAACCTGCCCGGCTACTGGCGGCGACCCCAATCTTGCTCCCCTGGACCAGACTCCGAACCGGTTCGATAACAGCTACTATCAGAAC
CTGGTGAACCGACGTGGGCTGCTTCATTCTGATCAGGAGCTGTTCAATGGTGGCTCTCAGGATGCAACTGTTAGGGGTTATAGTACGAATCCTGCCTCTTTTGCTAGAGACTTTGCTGCT
GCAATGGTCAAAATGGGCAATATTAGCCCACTCACTGGGACTAATGGAGAGATTAGGAGAAACTGCAGGGTGGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCTTCAATTTCTTATTTGTTTGTTACACTTATACTCACAATTATATCCCTTCTAGCTTGCACCTCCAATGCGCAACTTTCTCCAACCTTTTATGCAACATCTTGCCCCAATTTT
CAAAGAATCGCGAGGGATGAAATGACCAAAGCTGTTAATAGACAACCGCGTAATGCTGCCTCTATTCTTCGCCTCTTCTTCCATGACTGCTTCGTTAAT
GGCTGCGATGGGTCGGTACTA
CTAGATGACACAGCCACATTCACCGGCGAGAAGAATGCAGGACCAAACAGAAACTCTGCTAGGGGTTTTGAAGTGATTGACGCCATTAAAACTCGTCTGGAAGCAGCTTGCAACGCCACC
GTTTCATGTGCCGACATCCTTGCTGTTGCAGCCCGAGACGGTGTCGCCTTG
CTTGGAGGACCGACTTGGACGGTACCGCTCGGCCGGCGAGATGCAAGAACGGCCAGTCAGAGTGCAGCC
AATAGCCAAATCCCTGGACCATCCTCCAGCCTGGCAACACTCATATCAATGTTTGCAGCCAAAGGCCTGACCGCCCAAGACATGACAGTCCTCTCCGGCGGCCACGCCATCGGATTCGCT
CGATGCGCCGCCTTCCGGAACCGCATATACAACGACACCAACATTGACCCAGCTTTTGCAACCACCAGAAGAACAACCTGCCCGGCTACTGGCGGCGACCCCAATCTTGCTCCCCTGGAC
CAGACTCCGAACCGGTTCGATAACAGCTACTATCAGAACCTGGTGAACCGACGTGGGCTGCTTCATTCTGATCAGGAGCTGTTCAATGGTGGCTCTCAGGATGCAACTGTTAGGGGTTAT
AGTACGAATCCTGCCTCTTTTGCTAGAGACTTTGCTGCTGCAATGGTCAAAATGGGCAATATTAGCCCACTCACTGGGACTAATGGAGAGATTAGGAGAAACTGCAGGGTGGTTAATTAA

Retrieve as FASTA