Entry information : CsPrx27 (orange1.1g021118m/Cs3g26600)
Entry ID 8917
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx27 (orange1.1g021118m/Cs3g26600)
Name (synonym) CsPrx27 (orange1.1g021118m/Cs3g26600)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx27
start..stop
S start..stop
CclPrx51 647 0 1..317 1..317
CpapPrx26 558 0 4..316 9..321
MePrx114 553 0 13..317 16..320
RcPrx74 543 0 15..317 15..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4116098..4116301 204 N° 2 4115776..4115964 189 N° 3 4115460..4115622 163 N° 4 4114972..4115369 398
complement(join(4114972..4115369,4115460..4115622,4115776..4115964,4116098..4116 301))


exon

Literature and cross-references CsPrx27 (orange1.1g021118m/Cs3g26600)
DNA ref. Citrus sinensis Annotation Project:   chr3 (27841091..27842702) Phytozome 12:   scaffold00002 (4116301..4114972)
Protein sequence: CsPrx27 (orange1.1g021118m/Cs3g26600)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (295)
PWM (Da):   %s   34004.36 (31717.2)  
PI (pH):   %s   9.89 (9.89) Peptide Signal:   %s   cut: 23 range:23-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAVVALIFALAMFPVSSPVSALSSNYYSKTCPKLETAVTNAVKKAMKNDKTVPAALLRMHFHDCFIRGCDASVLLESKGKNTAEKDGPPNISLHAFYVIDNAKKAVEAMCPGVVSCADILALSARDAVALSGGPTWDVPKGRKDGRISKATDTRQLPAPTFNISQLQQSFSQRGLSMADLVALSGGHSLGFSHCSSFQNRIHNFNATLDIDPSISPSFATSLRHVCPAHNKVKNAGATLDSSTTVFDNAYYKLLLQGKSLFSSDQSLLTTPKTKALVSKFARSKSAFENAFVQSMIRMSSITGGGQEIRLDCRRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCCGTTGTAGCTCTCATATTTGCCCTTGCAATGTTTCCAGTTTCTTCTCCAGTGAGTGCACTTAGCTCAAATTACTACTCGAAGACGTGCCCCAAGCTTGAGACAGCGGTCACC
AATGCTGTAAAGAAAGCAATGAAGAACGACAAAACAGTTCCCGCAGCTCTACTTCGCATGCACTTCCACGATTGCTTTATCAGA
GTGCGTAATTAACCATCTCATTCTCAAATGAATAAA
ATTTTGGTATTAGCCACACCTTGTACGTGAAGAAAACAAATTTCAAATGTGATTATTAATCTTATGTGGTGGTTTTTTTTTTCTTTTATAATGTAAGGGTTGTGATGCTTCGGTTCTTCT
GGAGTCAAAGGGGAAAAACACAGCTGAGAAAGATGGACCTCCTAACATCTCGTTGCATGCCTTTTATGTCATCGATAACGCAAAGAAAGCAGTTGAAGCTATGTGCCCTGGTGTGGTTTC
TTGTGCTGATATCTTAGCTCTCTCTGCTCGAGATGCAGTTGCTTTG
GTTAGTTTATATATACATATATGTATGAACCCATAATTATAAACACTGTTCGATACAACTAATAAATCTCCCCA
CCAAAAAAAAAGTAAAAAAAAAAAGACTAAACATACATTTTTTGTTTGTTTGCTCTGCTGTTATGTGCTTACATACAAGTCTGGAGGTCCAACTTGGGATGTGCCGAAAGGGAGAAAAGA
CGGCAGAATTTCAAAAGCAACTGACACCAGACAGTTGCCAGCTCCCACCTTTAACATCTCTCAGCTTCAACAAAGCTTCTCCCAAAGAGGTCTTTCTATGGCTGATCTTGTCGCGCTCTC
AG
GTTAAAATGTTACTTTTGTAACTGTTGTGTTTCTGCTTAATTTTGACTGCAAAAATTAAAACGTGTATGCTAACCTCTAATTTTATATAGGAGGCCATTCTCTCGGGTTCTCTCACTG
CTCGTCCTTCCAAAACAGAATCCATAATTTTAATGCAACTCTTGACATTGACCCATCAATAAGCCCATCATTTGCAACAAGTTTGAGGCATGTGTGTCCGGCACACAACAAGGTGAAAAA
TGCCGGCGCCACGTTAGATTCATCAACAACAGTGTTTGACAATGCGTATTACAAGCTGCTTCTACAGGGGAAGAGTCTTTTCTCCTCAGATCAATCTTTGCTCACCACTCCAAAAACCAA
AGCCTTGGTTTCCAAGTTTGCCAGGTCCAAATCAGCATTTGAAAATGCTTTTGTGCAGTCCATGATCAGGATGAGTAGCATCACCGGTGGTGGTCAAGAGATTAGGCTTGATTGTAGAAG
AGTGAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCCGTTGTAGCTCTCATATTTGCCCTTGCAATGTTTCCAGTTTCTTCTCCAGTGAGTGCACTTAGCTCAAATTACTACTCGAAGACGTGCCCCAAGCTTGAGACAGCGGTCACC
AATGCTGTAAAGAAAGCAATGAAGAACGACAAAACAGTTCCCGCAGCTCTACTTCGCATGCACTTCCACGATTGCTTTATCAGA
GGTTGTGATGCTTCGGTTCTTCTGGAGTCAAAGGGG
AAAAACACAGCTGAGAAAGATGGACCTCCTAACATCTCGTTGCATGCCTTTTATGTCATCGATAACGCAAAGAAAGCAGTTGAAGCTATGTGCCCTGGTGTGGTTTCTTGTGCTGATATC
TTAGCTCTCTCTGCTCGAGATGCAGTTGCTTTG
TCTGGAGGTCCAACTTGGGATGTGCCGAAAGGGAGAAAAGACGGCAGAATTTCAAAAGCAACTGACACCAGACAGTTGCCAGCTCCC
ACCTTTAACATCTCTCAGCTTCAACAAAGCTTCTCCCAAAGAGGTCTTTCTATGGCTGATCTTGTCGCGCTCTCAG
GAGGCCATTCTCTCGGGTTCTCTCACTGCTCGTCCTTCCAAAAC
AGAATCCATAATTTTAATGCAACTCTTGACATTGACCCATCAATAAGCCCATCATTTGCAACAAGTTTGAGGCATGTGTGTCCGGCACACAACAAGGTGAAAAATGCCGGCGCCACGTTA
GATTCATCAACAACAGTGTTTGACAATGCGTATTACAAGCTGCTTCTACAGGGGAAGAGTCTTTTCTCCTCAGATCAATCTTTGCTCACCACTCCAAAAACCAAAGCCTTGGTTTCCAAG
TTTGCCAGGTCCAAATCAGCATTTGAAAATGCTTTTGTGCAGTCCATGATCAGGATGAGTAGCATCACCGGTGGTGGTCAAGAGATTAGGCTTGATTGTAGAAGAGTGAATTGA

Retrieve as FASTA