Entry information : GmAPx10 (Glyma11g08580.1)
Entry ID 8929
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-12-02 (Qiang Li)
Peroxidase information: GmAPx10 (Glyma11g08580.1)
Name (synonym) GmAPx10 (Glyma11g08580.1)
Class Ascorbate peroxidase     [Orthogroup: APx003]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmAPx10
start..stop
S start..stop
GmAPx05 312 5e-108 1..254 1..299
MtAPx05 252 3e-84 6..250 5..278
GmAPx06 245 1e-81 1..251 1..280
MeAPx09 237 2e-78 1..244 1..273
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6074093..6074208 116 N° 2 6074725..6074860 136 N° 3 6074990..6075037 48 N° 4 6076413..6076487 75
N° 5 6076595..6076677 83 N° 6 6076759..6076858 100 N° 7 6077091..6077297 207  
join(6074093..6074208,6074725..6074860,6074990..6075037,6076413..6076487,6076595 ..6076677,6076759..6076858,6077091..6077297)


exon

Literature and cross-references GmAPx10 (Glyma11g08580.1)
DNA ref. Phytozome 11:   Gm11 (6074093..6077297)
Protein sequence: GmAPx10 (Glyma11g08580.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   255
PWM (Da):   %s   29113.32 Transmb domain:   %s   o227-246i
PI (pH):   %s   9.77
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVEPIVVDEEYRKEIEMARRELGVFITNNKCAPLMLQFAWNDAATYDAKSRRGGPNGSIRLRIGQELKHEANKGLEKAVQYCGTKLKLKKVSYANLYQVLRKIFSRMGLSDEQDIVALCGGHTLGETHKDRSKFEEGKSTNKPLKFDNSYFKELLIKDASFSRLPMDYALVEDPKFHHYVERYADEEIFFKEYAISHKKLSELGFNLNNLDQPKGPYAKLNQHKGLIGIGIASVVVTVILGYLLKRKKNQLKN

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (long sequence in frame is missing due to 'n'). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGAACCTATTGTAGTTGACGAGGAGTATCGCAAGGAAATAGAAATGGCTCGACGAGAACTTGGCGTTTTCATCACCAACAATAAATGCGCCCCTCTCATGCTTCAATTTGCGTAC
CTCACACTACTTAATTACTGCTTTCATGTCTTTCTAGCTAATTCTCTCCATTGTCTCCGGTGGTTCGCAGAATTTTAGCGTGTTTGAATGAAATTTCATAGAATTGATTTTTGATTTAAG
TGTATGTTTAATTGGACGTTAGGTTATTTAAAATTGTATTGTTTACCTAAATAAACTTTTACATGTTTGATTCTACACAATTTTATTTAAAATCAATTTTACTTACACTTATATTCAAAC
ACACAAATATTGATTTTAAAGTGAAATGATTTATGGTTGAATGTTTTGATCATTAAAGTAAGTTAATAGAAAAATTCTGTATAAATATTTTTATCTTACATAAAAATGACCTAAAGTTGC
GCTAAGCCGTCAACTTATCGATCTTAAACCAAGAACCAATTGTGTTACATACAAATATACAATAAAAAAACATATGAAAAAATTACTTCAAATCTCATCAACTAATATTTTAACGTGAAA
TCAATCACACAATTAATTAAATTGTGGTACAGGTGGAATGATGCTGCAACTTACGATGCCAAGAGCAGAAGAGGAGGCCCCAACGGTTCTATCAGATTAAGGATTGGACAAGAGTTGAAA
CACGAAGCAAACAAGGGATTGGAAAAAGCAGTTCAATACTGTGGTCAA
TTTAATTTCTTCTTTTTCCTTTGACTGATCAAATGATCAATATGTACGTTTTTCAGTCTGTTTTTTTATTAC
TTTTCTTCGTTTTTATTTTAATGTAATTGGTTTCTTTCCCAAACAGAAATAGTGAAGACCAAACTTAAGCTTAAAAAAGTTTCATACGCGAACCTTTACCAGGTTATTTTAGTTTCTGAT
CCGCAACTGGTTATATATATAGTGATAATTAAACCACTTAATTAGACAACAGGGGATCCAATCAAATTAAGTTTGATGATATTAACTTGTATACGGTTGGATTTGCATTTCAGCTTGTGG
TGCTGTTGCAGTAGAGGTCACGGCAGAAAGGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTACTATTCAGATATGGATATCATTGAAAATATTTATATATGGGGTTGTGTAATTTATATAGAGAGAATTGTACTGATAATTTATCATAAG
ATTGTTTAACTTTCTTTTACTTTAACAACCCCTTTACATATATTTGTTTGGTTTAGAGCCTCTTAATCACGGTTTTCGGTTTTGATATGTTGCTAATTTACATATACTCTATTATTTTCT
TTATTAGGATTCAAATGAGTCTCCACGAACTGAAGGGCGCTTTATAGATGGTGAAGAAGGTAATAAATGTGTTGTGTAGTTGAGTTTCCTGTTTTCTTTAGGTTGGCTTCGCTGTTCAAA
TGTTATTACCATTTTTTACAACAATTTAATTTAGATTTTGCTAAAAAAATTTAACAATATTAATAAACCATAGCAAATATTAAAAGTACATGTACTAGTTTTTTCAATATTTTTTTATAT
ATAATAAACATTTTTTAATAAATTTTTATTTTTGCATCTTTAAACAGTAAGCAATGGCTAAAAAAATCAATTAAATTCTCCCTACAACTTAATTATAGCATACAATGTAATTTCATTACC
TTAAACGTTGTTAACTATTCGTTCCGTTTATGTTTATAGCATACAAAAAGGTGAACAGCACCAATAGGTTGTGATTGTAATTTCTTCTTGGTAAAATGCGTAGTTCATTTCTGCCTTATA
ATCTTGCTCCTTTGAGACACATTCTTGTAGAATTTCCTTAATTTTTCTAATATAAAGTTTAGAAATCTTTTGTAGAAACCTAGATACTTCACGTTATTTAAGTTAGATTTTGCCTCTCAT
TTCATAATTTATCGACTTTTCCATATAATTGTCGTGTTATATATCTTATGAATGATGAATGATAATAATTTACTTTGCCCATGCATGCATGCTAAAAGTGTTTGGTTGCGCTCCTCTGTT
TATTTGTAATTTGGATTTAGTTTTTAAAAACATTTAATAGACATGGTTTTCTTTCTAACCATTACGTATTGTGTCTGAGATCATATCCAAAGTATTTGTAATCTTGACTTACAATTGTTA
TGAAATTCTTTCACATGGAAAAAATTCAGATGCCAGGAATTTAAGAAAAATCTTCTCTCGTATGGGTCTGAGTGACGAGCAAGACATTGTGGCTCTATGTGGTGGCCACACTTTGATAAG
AACGATGTATCCAAAAGTCTCCATGGTAAGAACGATAAATATATATTTATTATCCTAAAAAAACGATATATAATTTCATATCTATTCACTTTATTTGATAAGGGTGAGACACATAAAGAT
CGCTCTAAGTTTGAAGAAGGAAAATCGACAAATAAACCTTTGAAGTTTGATAACTCCTATTTTAA
GTAAGTTGTTTAATCACACGGTGACAATTGTTTGTTTATTTTAGAAGTATAAAAA
TTGAAATTTCCCATAACACTAAACAGGGAACTATTGATTAAGGACGCATCCTTTTCGAGGCTTCCTATGGACTACGCTTTAGTAGAGGATCCAAAGTTCCATCACTATGTTGAACGGTAT
GCAAGG
TAACGACCATCCTATATAGAAGTTTAATGTAGTTAAAATTGATACATTTGGTAAAATTAGTAAATTACATTCATTAGACAAAATCAAAACAGTTCAAATTTCAATCTCGTACAT
GAATTCAAATTCTGAATCGTTTAACTTTTATTCAATGATTATGATATCTTAACCTGCATCAACTGTGCTCATTTTTCTACAGTATTTAAGTCTCGATCTTAATTTTCAATTGTGATAGGA
TGAGGAAATTTTTTTCAAAGAATATGCAATCTCACATAAGAAACTCTCTGAGCTAGGCTTCAATCTCAATAATCTAGATCAGCCCAAGGGACCATATGCGAAGCTAAATCAGCACAAAGG
ACTCATAGGAATAGGTATAGCATCAGTTGTGGTGACCGTCATATTAGGTTATTTACTGAAGAGGAAGAAAAACCAATTGAAAAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGAACCTATTGTAGTTGACGAGGAGTATCGCAAGGAAATAGAAATGGCTCGACGAGAACTTGGCGTTTTCATCACCAACAATAAATGCGCCCCTCTCATGCTTCAATTTGCGTGG
AATGATGCTGCAACTTACGATGCCAAGAGCAGAAGAGGAGGCCCCAACGGTTCTATCAGATTAAGGATTGGACAAGAGTTGAAACACGAAGCAAACAAGGGATTGGAAAAAGCAGTTCAA
TACTGTGGTCAA
ACCAAACTTAAGCTTAAAAAAGTTTCATACGCGAACCTTTACCAGGTTTTAAGAAAAATCTTCTCTCGTATGGGTCTGAGTGACGAGCAAGACATTGTGGCTCTATGT
GGTGGCCACACTTTG
GGTGAGACACATAAAGATCGCTCTAAGTTTGAAGAAGGAAAATCGACAAATAAACCTTTGAAGTTTGATAACTCCTATTTTAAGGAACTATTGATTAAGGACGCA
TCCTTTTCGAGGCTTCCTATGGACTACGCTTTAGTAGAGGATCCAAAGTTCCATCACTATGTTGAACGGTATGCAAGG
GATGAGGAAATTTTTTTCAAAGAATATGCAATCTCACATAAG
AAACTCTCTGAGCTAGGCTTCAATCTCAATAATCTAGATCAGCCCAAGGGACCATATGCGAAGCTAAATCAGCACAAAGGACTCATAGGAATAGGTATAGCATCAGTTGTGGTGACCGTC
ATATTAGGTTATTTACTGAAGAGGAAGAAAAACCAATTGAAAAAT

Retrieve as FASTA