Entry information : SbPrx143 (Sobic.010G245800.1 [2.1] / Sb10g028500 [1.4])
Entry ID 893
Creation 2008-10-19 (Christophe Dunand)
Last sequence changes 2008-10-19 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx143 (Sobic.010G245800.1 [2.1] / Sb10g028500 [1.4])
Name (synonym) SbPrx143 (Sobic.010G245800.1 [2.1] / Sb10g028500 [1.4])
Class Class III peroxidase    [Orthogroup: Prx114]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Callus
Cell culture
Embryos
Leaves
Roots
Seedlings
Inducers Heat shock stress
Nitrogen starvation
Oxidative stress
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx143
start..stop
S start..stop
SiPrx27 579 0 35..336 21..325
OsPrx90 569 0 4..336 5..337
ZmPrx69 566 0 40..336 37..331
HvPrx71 546 0 36..336 46..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 58310539..58310781 243 N° 2 58310908..58311099 192 N° 3 58312519..58312684 166 N° 4 58313183..58313592 410
join(58310539..58310781,58310908..58311099,58312519..58312684,58313183..58313592 )


exon

Literature and cross-references SbPrx143 (Sobic.010G245800.1 [2.1] / Sb10g028500 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_10 (58310539..58313592)
Cluster/Prediction ref. UniGene:   Sbi.2393
Protein sequence: SbPrx143 (Sobic.010G245800.1 [2.1] / Sb10g028500 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (305)
PWM (Da):   %s   36014.29 (32762.5) Transmb domain:   %s   i13-32o
PI (pH):   %s   9.52 (8.71) Peptide Signal:   %s   cut: 32 range:32-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRSRRSSPSWRRSVVAAVVIALAASWSAAAAAQAQLSQSYYASTCPNVETLVRGAVTQKLQETFNAAPGTLRLFFHDCFVRGCDASVLLSGPDDEHSAGADTTLSPDALDLVTRAKAAVDADPKCAYKVSCADILALAARDVVSQTGGPYYQVELGRLDGKVGTRAVVKHSLPGAGFDLDQLNKLFAANGLTQTDMIALSGGHTIGVTHCDKFVRRLYTFKGGRNSAGPPMNLNFLRQMRQTCPLNYTPSAFAMLDAVTPRKFDNGYYQTLQQMKGLLASDQVLFADRRSRATVNYFAANQTAFFDAFVAAMAKLGRVGVKTAADGEIRRVCTKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 10, 3 introns) and 15 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGTCGAGGAGGTCGTCGCCTTCGTGGCGGCGGAGCGTGGTCGCCGCGGTCGTCATAGCGTTGGCTGCGTCGTGGTCCGCGGCGGCGGCGGCGCAAGCGCAGCTGAGCCAGAGCTAC
TACGCTTCGACGTGCCCCAACGTGGAGACGCTGGTGCGCGGCGCCGTCACCCAGAAGCTGCAGGAGACCTTCAACGCGGCGCCGGGCACGCTCCGCCTCTTCTTCCACGACTGCTTTGTC
AGG
GTACGCGCGCTCCGGTCCATTCCATTTCATATCCGTCACTCACCATATGCGCAAGGATCCAGTGGATCGATTGACGTGCCCCGTCCCTGCCTGACCCTTGTTCTTCTGGTTCATTCC
GATTCCCAGGGCTGCGACGCGTCCGTGCTGCTGTCGGGCCCCGACGACGAGCACAGCGCGGGCGCCGACACGACGCTGTCACCGGACGCGCTGGACCTCGTCACCCGCGCCAAGGCCGCC
GTCGACGCCGACCCCAAGTGCGCCTACAAGGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCCCGCGACGTCGTCTCCCAG
GTACTCTACTTCTTCTTCTTCAGGCCTCCCATCCATCCA
AGATTCCAAGCTGCAGGCCGCAGCTACACACGCACGCCCCCAACTCCGGTAGAGAGAGAATTCGTTGGCGCTGTCGTCTCTGTTCACGTCACTTTCGGCGCCACAGACGAACAGAGAGGA
TGGGGGTGATGGGAAATGGAAACCCGGCGAGCCGTTTCGTTCCAGAAAAAGAAGTGGTTATGCCACTTTGGTCGATGGGGGATTACTGGATTAGCGACTCGGGGGGCTTACGTTACGCTT
AAACCCTACGCCATTAGCGCACCATCGTAATAAACTAGTAGTAATTAATCAACGATGCTAGTAGTGTTTTGGAGTGGTTTCTTTCCGGCGCGCCTCGGGCTTGTCCGGGCGACAGCTATG
ATGAGGCTGACATGTCCCGCGCGCTCATGGCCGAGGCGAACGACTCCTCCGCCGCAGGCCACAGCGGCAGCCAACACTGACTCTGAGCTGTGCCGCAATCATCCCAGTCCGTCCGCGCGT
GTCATGTCCAGCCAGGCCCCCCTGTCGTCTTCCTCCCCTGCTTCTCCTGGAGCCGGAGCTGGAGAGTGGAGTTTGGAGAGGCGAGTTTAGGCTAGGAGTTTTAGTATCAGCGCGAGCCAT
TGATCAAGTTTGAGCTGGCTGCAGAGTGCAGAGAGTAGGGGATGGGGATTCCAGAAAGAAAGAAAAAAGAAAAAAGAAAAATTTGTGTCCGGTTTGGCGCTAAAAAAGGGGGGATTGGGT
TTCGGTGGTGTGGTCCTGCCGTGTCCTGGTACTGCACCCTGTCGGAATTCTGCTGTCCCCGGCTCATTCATCACTCGGAGCAACAGCACGCGCGGTCCAGACTCCAGGGCAAGGGCAAGG
GCAAGGGGCAAGGCATGGCGCGAAGAGGAGATGCGACGCCCGGCTTGGACGACGGGACCGAGCGCCGGCGTTACTGCTCCTCGCTGGCTCGCTGCTGCGTCAGCGCGTGCCCGTGCCTTT
GAATTCTTCTCTGACGCGAAAGCAGACACGGTTTGGCGGCGTAAATGAGCCGGTACGGCGTCGACAGATACGAGCGCCCGACACCTAATCCGCCGGGCCGTGCAGTCCTGCAGTGCCTGG
ACGGACAGACCGGTGCACGTATACACGGAGTAGGAGTATTCCGTATACACGGGCACGGCCATCAGTTATTGTGCCGAGCAACTCGGCCGAAGTTTCTGATGCTCGGAGTCATTTCTGGCG
CACACACACACACGGCACGGACGTGTGCTGCTAGTACCGCGTCGGAGTACTTTACTACGTAGAGTAGTACTCCGTCGCAAGGCGCTGCAGCTCTTCGTGTACACGTACGCGTAGGCAATA
ATAAAAAAAAAAGAATTTTTACTACAGCACTTACCGATATGGTTGGAATTGGTGATGCAGACGGGCGGGCCGTACTACCAGGTGGAGCTGGGGCGGCTGGACGGCAAGGTGGGCACTCGC
GCCGTGGTGAAGCACAGCCTCCCCGGCGCCGGCTTCGACCTCGACCAGCTCAACAAGCTCTTCGCCGCCAACGGCCTCACGCAGACCGACATGATCGCCCTCTCAG
GTACGTCCGGAGTC
GAAAGCGGCGCCCCGACTGGTTCCGGTTTGGTTGGCCGGCAGCTGCATGCGGTTGCGGTCGCGACGCCGGACGCGGCTCATCATTCCGCCTCCGCTCACTCCCTTTCCCTGCTGCTCGAT
CACATTTGCTGCTGCTGCTGCTCGTAGAAACGCATGTCCTTTCCAGCCTGGCTCCGGGTGCGCCCGGTCCCTCCCTTCCCCAGCTTCCTCGCGCGCAGGGGCAGGGCAAGGGCATGGTCC
CGTGGAGGACTCCCCATGGCTCGCTGTTGCTGCTACTCTCGTGACCACTGCACTGACGAGATCACCACGCACAGTCACGTCACGGTCATAGCACTAGCACTAGCAGTAAAAACCCTGCAA
CTGTCCACTGCCACAGTCAGCGACCACGGCTGGCGATCCGCCGCTGACGCTGCCAGCTGCGAGCCACAGTGTCACTGAGCTGCAGCGCTGATCCCGACTGATCCAGCCAAACAAACGCAT
GCAGGTGGGCACACGATCGGCGTGACGCACTGCGACAAGTTCGTGCGGCGGCTGTACACGTTCAAGGGCGGCCGCAACAGCGCCGGCCCGCCGATGAACCTCAACTTCCTGCGGCAGATG
CGGCAGACGTGCCCGCTCAACTACACCCCGTCGGCGTTCGCGATGCTGGACGCCGTCACGCCGCGCAAGTTCGACAACGGCTACTACCAGACGCTGCAGCAGATGAAGGGCCTGCTGGCC
TCCGACCAGGTGCTCTTCGCCGACCGCCGGTCCCGCGCCACCGTCAACTACTTCGCCGCCAACCAGACGGCTTTCTTCGACGCCTTCGTCGCCGCCATGGCTAAGCTCGGACGCGTCGGC
GTCAAGACCGCCGCTGACGGCGAGATCCGCCGCGTCTGCACCAAGGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGTCGAGGAGGTCGTCGCCTTCGTGGCGGCGGAGCGTGGTCGCCGCGGTCGTCATAGCGTTGGCTGCGTCGTGGTCCGCGGCGGCGGCGGCGCAAGCGCAGCTGAGCCAGAGCTAC
TACGCTTCGACGTGCCCCAACGTGGAGACGCTGGTGCGCGGCGCCGTCACCCAGAAGCTGCAGGAGACCTTCAACGCGGCGCCGGGCACGCTCCGCCTCTTCTTCCACGACTGCTTTGTC
AGG
GGCTGCGACGCGTCCGTGCTGCTGTCGGGCCCCGACGACGAGCACAGCGCGGGCGCCGACACGACGCTGTCACCGGACGCGCTGGACCTCGTCACCCGCGCCAAGGCCGCCGTCGAC
GCCGACCCCAAGTGCGCCTACAAGGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCCCGCGACGTCGTCTCCCAG
ACGGGCGGGCCGTACTACCAGGTGGAGCTGGGGCGGCTGGACGGC
AAGGTGGGCACTCGCGCCGTGGTGAAGCACAGCCTCCCCGGCGCCGGCTTCGACCTCGACCAGCTCAACAAGCTCTTCGCCGCCAACGGCCTCACGCAGACCGACATGATCGCCCTCTCA
G
GTGGGCACACGATCGGCGTGACGCACTGCGACAAGTTCGTGCGGCGGCTGTACACGTTCAAGGGCGGCCGCAACAGCGCCGGCCCGCCGATGAACCTCAACTTCCTGCGGCAGATGCGG
CAGACGTGCCCGCTCAACTACACCCCGTCGGCGTTCGCGATGCTGGACGCCGTCACGCCGCGCAAGTTCGACAACGGCTACTACCAGACGCTGCAGCAGATGAAGGGCCTGCTGGCCTCC
GACCAGGTGCTCTTCGCCGACCGCCGGTCCCGCGCCACCGTCAACTACTTCGCCGCCAACCAGACGGCTTTCTTCGACGCCTTCGTCGCCGCCATGGCTAAGCTCGGACGCGTCGGCGTC
AAGACCGCCGCTGACGGCGAGATCCGCCGCGTCTGCACCAAGGTCAACTAG

Retrieve as FASTA