Entry information : GmAPx[P]11 (Glyma04g12130.1)
Entry ID 8930
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-11-28 (Qiang Li)
Peroxidase information: GmAPx[P]11 (Glyma04g12130.1)
Name (synonym) GmAPx[P]11 (Glyma04g12130.1)
Class Ascorbate peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmAPx[P]11
start..stop
S start..stop
GmAPx[P]15 139 4e-45 20..100 1..81
GmAPx[P]14 132 3e-42 1..74 1..74
GmAPx[P]13 115 5e-36 32..100 1..69
GmAPx[P]24 97 1e-28 42..100 1..59
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11117994..11118043 50 N° 2 11118147..11118396 250  
join(11117994..11118043,11118147..11118396)


exon

Literature and cross-references GmAPx[P]11 (Glyma04g12130.1)
DNA ref. Phytozome 12:   Gm04 (11117994..11118396)
Protein sequence: GmAPx[P]11 (Glyma04g12130.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   99
PWM (Da):   %s   10522.22 Transmb domain:   %s   i62-84o
PI (pH):   %s   6.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
RGFIAEKRCAPLMLCLAWHSAGTFDKGTKTSGPFGHCY*AFGATQGGVPYFELCRFLPGDEFFVFGVCALNAVFVLTQLAGVVVVEVTDGPEVPFHPGR

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from Phytozome (Two ends are missing. Stops in frame. Gap in frame).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGAGGCTTCATCGCTGAGAAGAGATGCGCTCCTCTAATGCTCTGTTTGGCGTGCGTTCTTTTTTATTCTTTTTATTTAACATTAGATCACTGTTATTTACGATTGAGTTTATGGATTGTC
GTTTTGACGCATTTTGGTGTGTTTCGTGTGCAGATGGCACTCTGCTGGAACCTTTGACAAGGGCACAAAGACTAGTGGACCCTTCGGACATTGCTATTAGGCTTTTGGAGCCACTCAAGG
CGGAGTTCCCTATTTTGAGCTATGCCGATTTCTACCCGGTGATGAGTTTTTTGTCTTTGGTGTTTGTGCGCTTAATGCTGTGTTTGTGTTGACACAGTTGGCTGGCGTTGTTGTCGTTGA
GGTCACGGATGGACCTGAAGTTCCATTCCACCCTGGAAGAGAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGAGGCTTCATCGCTGAGAAGAGATGCGCTCCTCTAATGCTCTGTTTGGCATGGCACTCTGCTGGAACCTTTGACAAGGGCACAAAGACTAGTGGACCCTTCGGACATTGCTATTAGGCT
TTTGGAGCCACTCAAGGCGGAGTTCCCTATTTTGAGCTATGCCGATTTCTACCCGGTGATGAGTTTTTTGTCTTTGGTGTTTGTGCGCTTAATGCTGTGTTTGTGTTGACACAGTTGGCT
GGCGTTGTTGTCGTTGAGGTCACGGATGGACCTGAAGTTCCATTCCACCCTGGAAGAGAG

Retrieve as FASTA