Entry information : GmAPx[P]12 ( Glyma05g14700.1)
Entry ID 8931
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-01-12 (Christophe Dunand)
Peroxidase information: GmAPx[P]12 ( Glyma05g14700.1)
Name (synonym) GmAPx[P]12 ( Glyma05g14700.1)
Class Ascorbate peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmAPx[P]12
start..stop
S start..stop
GmAPx[P]16 189 1e-64 1..100 1..100
GmAPx[P]19 183 3e-62 1..100 1..100
GmAPx[P]21 172 3e-58 1..100 1..100
GmAPx01 155 4e-49 1..99 5..120
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15818850..15818953 104 N° 2 15819047..15819171 125 N° 3 15819230..15819301 72  
join(15818850..15818953,15819047..15819171,15819230..15819301)


exon

Literature and cross-references GmAPx[P]12 ( Glyma05g14700.1)
DNA ref. Phytozome 12:   Gm05 (15818850..15819301)
Protein sequence: GmAPx[P]12 ( Glyma05g14700.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   100
PWM (Da):   %s   10826.8  
PI (pH):   %s   8.87
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
YRLVLPLCQKAVEKAKKLRGFIVEKRCTLLMLCLAWHSAGTFDKGTNTGGPFxDIAIRLLEPLKAEFPILSYADFYLLASVVAVEVTGGPEVPFHPGREV

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from Phytozome (Both 5' end and 3' end are missing. Gaps in frame).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TACCGTTTGGTTTTACCCCTTTGTCAAAAGGCCGTTGAGAAGGCAAAGAAGCTTAGAGGCTTCATCGTTGAGAAGAGATGCACTCTTCTAATGCTCTGTTTGGCGTGCATTTTTTTTATT
TAACATTAGATCACTGTTATTTACGATTGAGTTTATGGATTATCGTTTTGACGCGTTTTGGTGTGTTTCGTGTGCAGATGGCACTCTGCTGGAACCTTTGACAAGGGCACAAACACTGGT
GGACCCTTCGNNGACATTGCTATTAGGCTTTTGGAGCCACTCAAGGCGGAGTTCCCTATTTTGAGCTACGCCGATTTCTACC
TGGTGATGTTTTTTTGTCTTTGGTGTTTATGCACTTAA
TGTTGTGTTTGTGTTGACGCAGTTGGCTAGCGTTGTTGCCGTTGAGGTCACGGGTGGACCTGAAGTTCCATTCCACCCTGGAAGAGAGGTAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TACCGTTTGGTTTTACCCCTTTGTCAAAAGGCCGTTGAGAAGGCAAAGAAGCTTAGAGGCTTCATCGTTGAGAAGAGATGCACTCTTCTAATGCTCTGTTTGGCATGGCACTCTGCTGGA
ACCTTTGACAAGGGCACAAACACTGGTGGACCCTTCGNNGACATTGCTATTAGGCTTTTGGAGCCACTCAAGGCGGAGTTCCCTATTTTGAGCTACGCCGATTTCTACC
AGTTGGCTAGC
GTTGTTGCCGTTGAGGTCACGGGTGGACCTGAAGTTCCATTCCACCCTGGAAGAGAGGTAT

Retrieve as FASTA