Entry information : GmPrx102 (Glyma01g37630.1)
Entry ID 8932
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-18 (Christophe Dunand)
Peroxidase information: GmPrx102 (Glyma01g37630.1)
Name (synonym) GmPrx102 (Glyma01g37630.1)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx102
start..stop
S start..stop
GmPrx33 672 0 1..331 1..331
MtPrx46 603 0 1..330 1..330
MePrx01 575 0 1..330 1..330
CsPrx10 575 0 1..330 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 49956266..49956490 225 N° 2 49955771..49955962 192 N° 3 49955509..49955674 166 N° 4 49953814..49954226 413
complement(join(49953814..49954226,49955509..49955674,49955771..49955962,4995626 6..49956490))


exon

Literature and cross-references GmPrx102 (Glyma01g37630.1)
DNA ref. Phytozome 11:   Gm01 (49956490..49953814)
Protein sequence: GmPrx102 (Glyma01g37630.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (309)
PWM (Da):   %s   36416.85 (33861.4)  
PI (pH):   %s   9.26 (9.38) Peptide Signal:   %s   cut: 23 range:23-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVKSINFLLLLSLLAFAPLCHCKKKIGGYLYPQFYDGSCPRAQEIVQSIVAKAVAKEPRMAASLLRLHFHDCFVKGCDASVLLDSSGTIISEKRSNPNRDSARGFEVIDEIKSALEKECPHTVSCADILALAARDSTVLTGGPSWGVPLGRRDSLGASISGSNNNIPAPNNTFQTILTKFKLKGLDIVDLVALSGSHTIGNSRCTSFRQRLYNQTGNGKADFTLDQVYAAELRTRCPRSGGDQNLFVLDFVTPIKFDNFYYKNLLANKGLLSSDEILLTKNKVSADLVKQYAENNDIFFEQFAKSMVKMGNITPLTGSRGEIRKNCRRINK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGTCTATAAACTTTCTCCTACTTCTGTCTCTACTAGCCTTTGCTCCCTTATGTCACTGTAAAAAGAAAATAGGAGGTTACCTCTACCCTCAATTCTACGACGGTTCATGCCCC
AGAGCTCAAGAGATTGTCCAATCCATCGTTGCCAAGGCAGTGGCAAAAGAACCCCGCATGGCTGCTTCGTTGCTCAGACTACATTTCCATGATTGTTTTGTCAAG
GTCTCTATATATAAC
AGATAACAAACCCCATAACTTAGTTAATATAAATAGAAAATTCATAGTAGTGGCATAACTATCTGATCTATGAGTCTTGCTTATGTGCATATTATAGAATTTAGTATAATGATATATTGA
CAGCTACACAGTTTATACACCTAGTTGACACCTTTTATTCTTCTATCTTTTTTTGTCACGTTATATCACTTATTACATGTGTATTGTGTCTATGAGCACGAGTGTACATGAATTATTTTT
GTAGAACTTATATGGCTCAAATGCATGACTCAAAGTTTAATGTTTCAGGGCTGTGATGCATCGGTGCTGCTAGATAGCAGTGGAACTATTATCAGTGAGAAGAGGTCAAATCCCAACCGT
GATTCAGCCCGAGGATTTGAAGTCATTGATGAAATTAAATCTGCACTAGAGAAGGAATGCCCACATACAGTGTCATGTGCTGACATTTTGGCTCTAGCTGCTAGAGATTCAACTGTTCTT
GTAAGTATCTTTTTTTTTTTTTTGCACTCTAATACCCTTATCTTGATATTTGACTATCAAAACTTTATTATCAAGCCTTATTTATAATCTCTGCAGACGGGGGGACCAAGCTGGGGAGTA
CCTTTGGGCAGAAGGGACTCTCTTGGTGCGAGTATTAGTGGCTCAAATAACAACATTCCTGCTCCCAACAACACATTCCAGACCATTTTAACTAAGTTCAAGCTTAAGGGGCTTGACATT
GTTGATCTAGTTGCTCTATCTG
GTAAGACTCCCAGTACTTTATTTGTCTATGGTTTTTTGCCTTCAAAGCATGTAGGTTTATGGTTATAATTTGTTTTGATGAGTATTTACAAACTTAAC
CTTAGATGCGGTTAAAATTGAGTTTAAAGCAAAATCATGTATATTTCAAAACTTTTATTCCAAAATCAACTTTGCAGTAAAATTTACTATACAATTTTCAACTAAACACAATAATTACAT
TTTTTTATTTTTTTTACAGAATACATTTTTTTTAGTTAAATGCACTTTTGGAAACAAACTTGATTTTATTTTAATGTAATGAGACATACACAAATTTTGCAAAACATGTTTTTGTGCTTC
AAAAGTAAGCGAGAGAGTCTCATTGATTTTCAATGGAAGTGAAAATAGGTTGGGTTGAACAAAATTTTGTTTAAATGGACTAGGTCTAGCTGGAAAAAAAATGGACTTGATTATTTAAAA
AATTTAGTCTAAATTTGGTCTATTACATATTATAAACTTTATTTTAGGTTTAATCTAAGTTTGATTTGACCTATAAACCTATCTAAAAACTTATTTGATATTAAAGTTTTTACAAAGGTC
TTCTTTCTACATGAGCTAATAAGCTCATAGGCCAATCGAAAAAAATTCTACATAAATAAAACTATAATTTATAAAATTAAAATGATTGATACTCAAAGCAATGATGAGACAAATGTGCAA
ATAGTAGATTAGATTTTATAAAAGTCTAGTCTAATATATTTATATGATACAAATTTATTTTTTATGTCTAATTTCACCTTTTGAACACTTGTTTAAAAGTCTATTTTGTAATAACATTTG
TAAACAAGGCATAAATTTATCCCTTATACTATTGCTCTCCAACTCTGCAATTCTAAATCGCCATCCACCTTTATTTTCTTGAGACCAATATATGTTTGGATGAGAATTTGTAAATTCAAT
TTTAAATAAACTTGATTTTATAAAATTAATTTTGGTTAGAAGTCAATTTGGAGTGAAGTGATTTATATTTAAAAATTTGTATTTTTTTAATTAACAAATTGTATCTTAAACTCAGGTATA
TATTAGCATTGTATGAAAATTTTACCCAACGCAGAAGTTACTTTTTTTTTTCACTTTCAAACAAATGGGCTTTGGGAGCAAACTTTGACTTTGACAAAATACAATCAAACATGATATTTT
GTTGTGAAATCCCATTTGGACTATATCAGCGTGCGTTTGATAGTTTCAATTATTGGTATTTTAAAGCTGCATTTCCAGCATAAACAATATTTGTAATGTTATAGGGAGCCACACTATAGG
AAATTCCCGATGCACCAGCTTCAGGCAAAGACTATACAACCAAACAGGCAATGGAAAAGCAGACTTCACTCTTGATCAAGTGTATGCTGCTGAATTGCGCACTAGGTGTCCAAGATCTGG
TGGGGACCAGAATCTCTTTGTCCTAGACTTTGTTACCCCAATTAAATTTGACAACTTCTATTACAAGAACTTGCTGGCTAACAAGGGTCTCTTAAGTTCTGACGAAATTCTCTTGACAAA
GAATAAAGTATCCGCGGATTTAGTGAAGCAGTATGCAGAAAACAACGATATTTTCTTTGAACAATTTGCCAAGTCCATGGTTAAGATGGGAAACATTACTCCTTTAACAGGGTCAAGGGG
TGAGATCAGAAAGAACTGCAGAAGAATTAACAAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGTCTATAAACTTTCTCCTACTTCTGTCTCTACTAGCCTTTGCTCCCTTATGTCACTGTAAAAAGAAAATAGGAGGTTACCTCTACCCTCAATTCTACGACGGTTCATGCCCC
AGAGCTCAAGAGATTGTCCAATCCATCGTTGCCAAGGCAGTGGCAAAAGAACCCCGCATGGCTGCTTCGTTGCTCAGACTACATTTCCATGATTGTTTTGTCAAG
GGCTGTGATGCATCG
GTGCTGCTAGATAGCAGTGGAACTATTATCAGTGAGAAGAGGTCAAATCCCAACCGTGATTCAGCCCGAGGATTTGAAGTCATTGATGAAATTAAATCTGCACTAGAGAAGGAATGCCCA
CATACAGTGTCATGTGCTGACATTTTGGCTCTAGCTGCTAGAGATTCAACTGTTCTT
ACGGGGGGACCAAGCTGGGGAGTACCTTTGGGCAGAAGGGACTCTCTTGGTGCGAGTATTAGT
GGCTCAAATAACAACATTCCTGCTCCCAACAACACATTCCAGACCATTTTAACTAAGTTCAAGCTTAAGGGGCTTGACATTGTTGATCTAGTTGCTCTATCTG
GGAGCCACACTATAGGA
AATTCCCGATGCACCAGCTTCAGGCAAAGACTATACAACCAAACAGGCAATGGAAAAGCAGACTTCACTCTTGATCAAGTGTATGCTGCTGAATTGCGCACTAGGTGTCCAAGATCTGGT
GGGGACCAGAATCTCTTTGTCCTAGACTTTGTTACCCCAATTAAATTTGACAACTTCTATTACAAGAACTTGCTGGCTAACAAGGGTCTCTTAAGTTCTGACGAAATTCTCTTGACAAAG
AATAAAGTATCCGCGGATTTAGTGAAGCAGTATGCAGAAAACAACGATATTTTCTTTGAACAATTTGCCAAGTCCATGGTTAAGATGGGAAACATTACTCCTTTAACAGGGTCAAGGGGT
GAGATCAGAAAGAACTGCAGAAGAATTAACAAGTGA

Retrieve as FASTA