Entry information : GmPrx135 (Glyma03g04880.1)
Entry ID 8955
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-23 (Christophe Dunand)
Peroxidase information: GmPrx135 (Glyma03g04880.1)
Name (synonym) GmPrx135 (Glyma03g04880.1)
Class Class III peroxidase    [Orthogroup: Prx172]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx135
start..stop
S start..stop
MtPrx32 425 1e-150 12..330 13..340
MtPrx24 423 8e-150 9..330 10..338
AhPrx04 416 2e-147 11..330 11..316
EcamPrx21 406 2e-143 33..330 23..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5077977..5078222 246 N° 2 5076732..5076923 192 N° 3 5076172..5076337 166 N° 4 5075560..5075948 389
complement(join(5075560..5075948,5076172..5076337,5076732..5076923,5077977..5078 222))


exon

Literature and cross-references GmPrx135 (Glyma03g04880.1)
DNA ref. Phytozome 12:   Gm03 (5078222..5075560)
Protein sequence: GmPrx135 (Glyma03g04880.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (308)
PWM (Da):   %s   35768.1 (33319.9) Transmb domain:   %s   o10-32i39-61o
PI (pH):   %s   8.39 (8.37) Peptide Signal:   %s   cut: 23 range:23-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGCSQQRLIVMFLCLIGIVSATDLTSSAVSLADYELSTTFYLLKCPLGLFTINNLVTAAVRKESRMGASLLRLHFHDCFVQGCDASVLLKNTATFTGEQGAFPNANSLRGFEVIDNIKAKLEILCPGVFSCADILAVAARDSVVALGGLGWQVRLGRRDSTTASLSGANSDLPAPFLGLTDLVAAFQKKGFTVNEMVALSGAHTIGSARCLTFRSRAYNDSDIEPSYANFLRSNCPKSGGDDNLSPIDIATKDIFDNAYYRNLLYKKGLFHSDQQLYSGSFTDSKVKYYATYPSLFFKSDFANAMLKMSNLSPLTGTQGQIRKVCSRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGGATGTTCTCAACAAAGGCTGATTGTTATGTTTTTATGTCTCATTGGGATAGTTTCAGCTACAGATTTAACTTCTTCAGCTGTGAGTTTAGCTGATTATGAGTTAAGCACCACT
TTTTATCTTTTAAAGTGTCCCCTGGGCCTCTTTACCATTAATAACCTAGTAACCGCTGCTGTGCGGAAAGAGTCTCGCATGGGTGCATCCTTGCTCCGTCTTCATTTCCATGATTGCTTT
GTCCAA
GTAAGTCATTAATTAATCTTATTGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTTTTTTTTTTTGAATTAATATAGTGTGTG
GGATGTAATGTGTATACTGTGGTGACTGTTAAATCGTAACTGAGACATAAATTTAACTTGTGAAACATTAATATAATGCAAATTAATACATATAGAGGACTGCGACTTTTTTTCTAAACC
TTTTCCCCTTTTAATTTTATTATAATTAATATAATTTTAGTCCCGTAATAATTATTATAGTAATAAGAAATATCTCAACTTTTTAATTACTTTTTCAATAATTTGGTCGTCCAATTACTA
ATAATAGAAATTAGTACGCAATTTAAAATTTACGTGTGGGATATTACAATTATTGACTAAAATGTTTTAATCGTCTCAATGATGACTTCTTCAATCTATTAAAGTATGCCATTTTCTTTC
ATGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTAAATATTTAAATATATTAAAGTTATTAGTTGTTCCATA
AGAACATTAATATCGGTAACATCTTGATTTTTTAAAGAATTTAATTTATCCATGTATAAGGTAGTTTGTATATATTGTATCTGTAAGATAAAATATATACGTATGTGATTTTTTTCCCTT
ACAACGTGGATTCAACCGATAATGCTGCTCTTACTTCCATTAAGATGCCAATTTTATAGCGTGCGGTGAAGTCACGTTGTTAACCATATGATCCGTTTTTATTAATAATTGGATGAATGG
AAGGACGTGACACTTTTAATTAGAATAATTGAAAATTTTAATTGTTTCAAAAGAATATATATTGAAGAGCAAAAGTATAATTAACCGATATTTTGCATCTATTAGATAAAATACAACAAT
TAGTCGTGTATATTTTTACTTATTATTAAATAAACATATAACGTGAAATGAAAAGCATGACTAATTATTAAAACATGTTCTTATTTTTGCTCTTTGCAGGGATGTGATGCATCGGTTTTG
TTAAAGAACACTGCAACTTTCACGGGCGAACAAGGTGCCTTCCCCAACGCTAATTCTCTAAGGGGTTTCGAAGTCATAGACAACATAAAAGCAAAATTAGAGATTTTGTGCCCTGGGGTT
TTCTCTTGCGCTGACATCTTAGCCGTTGCTGCAAGGGATTCTGTTGTTGCT
GTAAGTACTTGTTTCAGAAATAACCAATTAAATAAGCAAAATCAGAAGACACTTCTACAAGAAATTATT
TAAGCTCTATACATTGATATTATAAAAAGATTTTTCAATCAATATTAGTATAACTTTTTAAGTTAGCTATTATTATAAAAAGTTAACAAGTTTATTATTATACAAGATAAACTTTTTATT
AGACGATAATATAATATTATTTTATACTGTTAGATTCAAACTTTATTTTCTCGAGATGTGAAACTAATCGGTGCAAAATAATTCTCTCAGCTTGGTGGATGATATTTTTTTATTGGACGA
TAGTATGATATTGTTTTACATTTTTAGATCTTAATCTATCTTCTCTTGAGATGGGAATCTAATCGGTGTGAAATAATTCTCTCAGCTTGGTGGACTTGGGTGGCAAGTTCGCTTGGGGAG
AAGGGACTCAACCACTGCAAGTTTAAGTGGAGCTAACTCAGATTTACCAGCTCCCTTTCTGGGTCTTACTGACCTTGTTGCTGCTTTCCAAAAGAAGGGTTTCACAGTAAATGAAATGGT
TGCTTTATCAG
GTAGATACCCATTATTGCATGCATCTTAGCAAGTTTTACACATGTTGTTAGTATGTTACCATGCACAAGGAAAATTAGGTTTCTGTTATATAATAAAGACTTGTATAAG
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTAATGGATCAGGTGCTC
ACACAATAGGCAGCGCCAGGTGTTTAACCTTCCGATCAAGGGCTTACAACGATAGCGATATAGAACCCTCGTATGCAAATTTCTTGAGAAGCAACTGTCCCAAGAGTGGTGGTGATGACA
ACTTGTCTCCTATAGATATCGCCACTAAAGACATTTTTGACAATGCTTACTACCGGAATTTACTTTACAAAAAGGGTCTTTTCCACTCTGACCAACAGCTCTATAGTGGCAGTTTCACGG
ACTCCAAAGTTAAATATTATGCCACCTACCCATCACTTTTCTTCAAATCAGATTTCGCTAACGCCATGCTCAAGATGAGCAACCTTAGCCCACTTACAGGGACACAGGGTCAGATCAGAA
AAGTATGCAGCAGAGTGAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGGATGTTCTCAACAAAGGCTGATTGTTATGTTTTTATGTCTCATTGGGATAGTTTCAGCTACAGATTTAACTTCTTCAGCTGTGAGTTTAGCTGATTATGAGTTAAGCACCACT
TTTTATCTTTTAAAGTGTCCCCTGGGCCTCTTTACCATTAATAACCTAGTAACCGCTGCTGTGCGGAAAGAGTCTCGCATGGGTGCATCCTTGCTCCGTCTTCATTTCCATGATTGCTTT
GTCCAA
GGATGTGATGCATCGGTTTTGTTAAAGAACACTGCAACTTTCACGGGCGAACAAGGTGCCTTCCCCAACGCTAATTCTCTAAGGGGTTTCGAAGTCATAGACAACATAAAAGCA
AAATTAGAGATTTTGTGCCCTGGGGTTTTCTCTTGCGCTGACATCTTAGCCGTTGCTGCAAGGGATTCTGTTGTTGCT
CTTGGTGGACTTGGGTGGCAAGTTCGCTTGGGGAGAAGGGAC
TCAACCACTGCAAGTTTAAGTGGAGCTAACTCAGATTTACCAGCTCCCTTTCTGGGTCTTACTGACCTTGTTGCTGCTTTCCAAAAGAAGGGTTTCACAGTAAATGAAATGGTTGCTTTA
TCAG
GTGCTCACACAATAGGCAGCGCCAGGTGTTTAACCTTCCGATCAAGGGCTTACAACGATAGCGATATAGAACCCTCGTATGCAAATTTCTTGAGAAGCAACTGTCCCAAGAGTGGT
GGTGATGACAACTTGTCTCCTATAGATATCGCCACTAAAGACATTTTTGACAATGCTTACTACCGGAATTTACTTTACAAAAAGGGTCTTTTCCACTCTGACCAACAGCTCTATAGTGGC
AGTTTCACGGACTCCAAAGTTAAATATTATGCCACCTACCCATCACTTTTCTTCAAATCAGATTTCGCTAACGCCATGCTCAAGATGAGCAACCTTAGCCCACTTACAGGGACACAGGGT
CAGATCAGAAAAGTATGCAGCAGAGTGAATTAA

Retrieve as FASTA