Entry information : GmPrx138 (Glyma03g36620.1)
Entry ID 8958
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-10-18 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-11-28 (Qiang Li)
Peroxidase information: GmPrx138 (Glyma03g36620.1)
Name (synonym) GmPrx138 (Glyma03g36620.1)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx138
start..stop
S start..stop
GmPrx137 602 0 1..324 1..322
MtPrx04 551 0 1..323 1..320
GmPrx37 541 0 3..324 1..322
GmPrx66 531 0 24..324 9..309
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 43535734..43535943 210 N° 2 43535386..43535577 192 N° 3 43535125..43535290 166 N° 4 43534284..43534690 407
complement(join(43534284..43534690,43535125..43535290,43535386..43535577,4353573 4..43535943))


exon

Literature and cross-references GmPrx138 (Glyma03g36620.1)
DNA ref. Phytozome 12:   Gm03 (43535919..43534284)
Protein sequence: GmPrx138 (Glyma03g36620.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (302)
PWM (Da):   %s   35393.95 (32963.7) Transmb domain:   %s   i5-25o
PI (pH):   %s   8.21 (8.00) Peptide Signal:   %s   cut: 23 range:23-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKMRFFLVACLAVFCILGVCQGGNLRKKFYKKTCPQAEEIVRTKIQEHVSARPDLPAKLIRMHFHDCFVRGCDGSVLLDSTATNTAEKDSIPNLSLAGFDVIDDIKEALEAKCPGTVSCADILALAARDTVSVKFNKPTWEVLTGRRDGTVSISGEALANLPAPFFNFTQLKESFASKGLTVHDLVVLSGAHTIGIGHCNLFSNRLFNFTGKGDQDPSLNPTYANFLKTKCQGLSDTTTTVEMDPNSSNTFDSDYYSILRQNKGLFQSDAALLTTKISRNIVNELVNQNKFFTEFGQSMKRMGAIEVLTGSAGEIRKKCSVVNS

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (short 5' end is missing due to frame shift => extra g). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGATGAGATTTTTTCTTGTAGCTTGTTTGGCAGTGTTCTGCATCCTAGGGGTTTGCCAAGGAGGCAACCTCAGAAAGAAATTCTACAAGAAAACATGTCCTCAAGCTGAGGAGATT
GTTAGGACGAAAATCCAGGAACATGTCTCTGCAAGGCCTGATTTGCCTGCCAAGTTGATTAGAATGCATTTTCATGATTGTTTTGTCAGG
GTAAACATTCCTAGTCCTATAGCTCTGTAT
GAATACTAATTACACCCTATGTGCATCATTTCAAATTTAAATACAACAATGCTAATTTCCATGCAACTTTGTTTTAGAGCTACATATATAATTATTCACATGACATGGTTGTAAACGACA
TTTCAGGGTTGTGATGGTTCAGTTTTGCTGGACTCCACTGCCACCAACACTGCAGAGAAGGACTCCATTCCCAACTTATCTTTGGCTGGCTTTGATGTCATAGATGACATTAAAGAAGCA
TTGGAGGCTAAATGTCCCGGAACTGTGTCTTGTGCTGATATATTAGCATTGGCAGCTAGGGATACTGTTTCTGTCAAA
GTAAGCTAAAGCTAACCATAATATATAGTACACAATTTGTGT
ATGTTTTCATGTAACATTAGTTCATGCATGTAGCTGATTGACAATATTTGCAGTTTAATAAGCCAACATGGGAAGTACTTACCGGTAGAAGAGATGGCACAGTATCCATAAGTGGTGAAG
CCTTAGCTAATCTGCCAGCACCTTTCTTCAACTTCACCCAGCTCAAAGAAAGCTTTGCTAGCAAAGGGCTTACTGTGCATGACTTGGTTGTATTATCAG
GTACATTTAATATTTTATAAA
CTCAATGTTAAACATAAATAATATTGCCTCCATTCCTTTTTATAAGAAACAAGTTATAGTGTAAATACACTATAACTTATTTCTTATAAAAAGATATTAATAATACTACTAAGAACCAGA
TTTAGATGCAGTATCTTATATTTTAGAACTGTTTTTACATTTTGAATTGGAATTTTGTTTTAGTAATTCATATAATGAAAGTTTGCAATATTAAATGTGTTAACTAAGGTTAATTACTAA
GATTAAACTTCAATTTTTAATTGTGCAACGTTACTTAAAACATTCAAGGAACTACATCCATTTTTTTTTATTTCCAAATACTAATGGCAATCAAGGAATCACCCAAATTATCAGAGCAAA
ATCATCTATTAAAAGGGACTAAATTAACCTATTGGCTATGTATGTATATATAGGAGCACACACAATTGGGATAGGTCACTGCAACTTATTCAGTAACAGGCTTTTCAATTTCACCGGAAA
AGGTGATCAAGATCCTTCATTGAATCCTACTTATGCCAATTTCTTGAAGACAAAATGCCAAGGTCTCAGTGACACCACCACAACAGTAGAGATGGATCCTAACAGCTCAAACACCTTTGA
CAGTGACTATTATTCTATCCTTCGCCAGAATAAGGGTCTATTCCAATCAGATGCTGCTCTTTTAACAACTAAGATATCAAGAAACATTGTCAACGAATTGGTTAATCAAAACAAGTTCTT
CACAGAGTTTGGACAGTCAATGAAGAGAATGGGAGCCATTGAGGTCCTCACTGGCTCTGCTGGGGAAATAAGGAAGAAGTGCTCTGTTGTCAACTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGATGAGATTTTTTCTTGTAGCTTGTTTGGCAGTGTTCTGCATCCTAGGGGTTTGCCAAGGAGGCAACCTCAGAAAGAAATTCTACAAGAAAACATGTCCTCAAGCTGAGGAGATT
GTTAGGACGAAAATCCAGGAACATGTCTCTGCAAGGCCTGATTTGCCTGCCAAGTTGATTAGAATGCATTTTCATGATTGTTTTGTCAGG
GGTTGTGATGGTTCAGTTTTGCTGGACTCC
ACTGCCACCAACACTGCAGAGAAGGACTCCATTCCCAACTTATCTTTGGCTGGCTTTGATGTCATAGATGACATTAAAGAAGCATTGGAGGCTAAATGTCCCGGAACTGTGTCTTGTGCT
GATATATTAGCATTGGCAGCTAGGGATACTGTTTCTGTCAAA
TTTAATAAGCCAACATGGGAAGTACTTACCGGTAGAAGAGATGGCACAGTATCCATAAGTGGTGAAGCCTTAGCTAAT
CTGCCAGCACCTTTCTTCAACTTCACCCAGCTCAAAGAAAGCTTTGCTAGCAAAGGGCTTACTGTGCATGACTTGGTTGTATTATCAG
GAGCACACACAATTGGGATAGGTCACTGCAAC
TTATTCAGTAACAGGCTTTTCAATTTCACCGGAAAAGGTGATCAAGATCCTTCATTGAATCCTACTTATGCCAATTTCTTGAAGACAAAATGCCAAGGTCTCAGTGACACCACCACAACA
GTAGAGATGGATCCTAACAGCTCAAACACCTTTGACAGTGACTATTATTCTATCCTTCGCCAGAATAAGGGTCTATTCCAATCAGATGCTGCTCTTTTAACAACTAAGATATCAAGAAAC
ATTGTCAACGAATTGGTTAATCAAAACAAGTTCTTCACAGAGTTTGGACAGTCAATGAAGAGAATGGGAGCCATTGAGGTCCTCACTGGCTCTGCTGGGGAAATAAGGAAGAAGTGCTCT
GTTGTCAACTCTTAA

Retrieve as FASTA