Entry information : GmPrx158 (Glyma06g15030.1)
Entry ID 8961
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx158 (Glyma06g15030.1)
Name (synonym) GmPrx158 (Glyma06g15030.1)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx158
start..stop
S start..stop
GmPrx328 634 0 1..320 1..320
GmPrx61 550 0 1..320 1..326
GmPrx80 550 0 1..320 1..324
LjPrx30 548 0 3..320 4..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11823008..11823220 213 N° 2 11823680..11823871 192 N° 3 11823994..11824159 166 N° 4 11824426..11824817 392
join(11823008..11823220,11823680..11823871,11823994..11824159,11824426..11824817 )


exon

Literature and cross-references GmPrx158 (Glyma06g15030.1)
DNA ref. Phytozome 12:   Gm06 (11823008..11824817)
Protein sequence: GmPrx158 (Glyma06g15030.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (296)
PWM (Da):   %s   34464.15 (31854.8)  
PI (pH):   %s   8.84 (8.91) Peptide Signal:   %s   cut: 25 range:25-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASFCSRLTICLALFVLILGSANAQLSTNFYYHSCPNLFSTVKSTVQSAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSFTGEKNANPNRNSARGYEVIDNIKSAVEKACPGVVSCADILAIAARDSVQILGGPSWNVKVGRRDARTASQSAANNGIPPPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQARCTNFRARIYNESNIDTAFARTRQQSCPRTSGSGDNNLATLDLQTPTEFDNYYFKNLVQKKGLLHSDQQLFNGGSTDSIVRGYSTNPSSFSSDFAAAMIKMGDISPLTGSNGEIRKNCRRIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 3 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGTTTTGTTCTAGATTGACCATTTGTTTGGCTCTGTTTGTCCTCATATTGGGGAGTGCCAATGCCCAACTTTCTACAAACTTCTACTACCATTCGTGTCCAAACCTCTTCTCC
ACTGTGAAATCCACAGTGCAATCTGCCATATCAAAGGAGACCCGCATGGGTGCTTCTCTCCTCCGCCTGTTCTTCCACGATTGCTTTGTCAAT
GTAATTTATATGCACCTTCTCAAACAT
ACATATAAATATGCTAATCAGCATACCTATAGCTTCAGGCTTTTGCTTCTACCCCATGCATGCAGCAACTATGTTTTTTTTTTTTTTGTGATTCATCAACTAATTTTTTTGAACAACACA
AGTTACTTTTATTTTAGATATCATCTGAGAAAATCTCGTCATACATAATCATGCCATGTGAACTGCTAACTCATTTAAAAAATTAAATCCTTTACTGTTTAGAACCTTCTTACTTCTTAG
CTAGCTAACAAGTTAAAAATGATAATTTTTTTTTAAAAAAAGTTATTAAGAACCTTGGTGAGGATTAATATTTTTCATCTTATTTACTTGTAGCCTGCAACTTTTAAGTTTTTACTGCTT
GATTCAAATTTTTGGTTTACCAAAAGAAAGGGAGGGCTGGAATATTTATGAATAAAACCTTAACAAATGCAGGGATGTGATGGTTCAATTCTATTGGATGACACATCAAGCTTCACCGGA
GAGAAGAACGCAAACCCCAACAGGAACTCTGCTCGTGGATACGAGGTCATTGACAACATTAAATCAGCCGTGGAGAAAGCATGTCCAGGAGTTGTCTCCTGCGCAGATATCCTTGCCATA
GCTGCCAGAGACTCTGTTCAGATC
GTAAGTGGCCAAAAAACCAACAAAAACACATTAAACTAAATCATTAAATTAATTACTAATTTAGTACAACACATGCAAGAATGTGAATTTAAATGT
TTTGTTGATTTTGATCATCATATTAGCTTGGAGGCCCTAGTTGGAATGTTAAAGTTGGAAGAAGAGACGCTAGAACTGCTAGCCAATCTGCTGCTAACAATGGCATCCCTCCACCCACTT
CAAACCTTAACCAACTCATCTCAAGATTCAGCGCTCTTGGACTTTCCACCAAGGACTTGGTCGCCTTGTCCG
GTACAAAACATATATCACATATTTTTCCAATTGATAATAACATTTCAA
TCATATAGTAAAATTTCTTAATTAATCAGGGATATGAGAAATGTTAGTCACACACTCAGTTGAAATTTATTGGAGATGACAACTTTTGTGGATTTCACATCAAATATTTAATGATTCTCT
ATTCTAATTTTGTATTTTTCAATAAACTTTAATCAATTACAGAAAATGTATTTGTAGCACTGCTAACATTGCATGTTATATAATTTTTCTTTCGTTAGGTGGTCACACAATTGGACAAGC
AAGGTGCACAAACTTCAGAGCCCGCATCTACAACGAGAGCAACATAGACACCGCATTTGCAAGGACAAGGCAACAAAGCTGCCCAAGAACATCAGGGTCAGGGGACAATAATCTTGCAAC
GCTTGATCTTCAAACTCCAACCGAATTCGACAACTACTACTTCAAGAATCTTGTTCAGAAGAAGGGTCTCCTCCACTCTGATCAGCAACTGTTCAATGGTGGGTCCACCGACTCCATTGT
GCGTGGCTACAGCACCAACCCGAGCTCCTTCTCCTCTGACTTCGCCGCCGCCATGATCAAGATGGGAGACATTAGTCCTCTCACTGGCTCCAACGGAGAAATCAGGAAGAATTGTAGAAG
GATTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGTTTTGTTCTAGATTGACCATTTGTTTGGCTCTGTTTGTCCTCATATTGGGGAGTGCCAATGCCCAACTTTCTACAAACTTCTACTACCATTCGTGTCCAAACCTCTTCTCC
ACTGTGAAATCCACAGTGCAATCTGCCATATCAAAGGAGACCCGCATGGGTGCTTCTCTCCTCCGCCTGTTCTTCCACGATTGCTTTGTCAAT
GGATGTGATGGTTCAATTCTATTGGAT
GACACATCAAGCTTCACCGGAGAGAAGAACGCAAACCCCAACAGGAACTCTGCTCGTGGATACGAGGTCATTGACAACATTAAATCAGCCGTGGAGAAAGCATGTCCAGGAGTTGTCTCC
TGCGCAGATATCCTTGCCATAGCTGCCAGAGACTCTGTTCAGATC
CTTGGAGGCCCTAGTTGGAATGTTAAAGTTGGAAGAAGAGACGCTAGAACTGCTAGCCAATCTGCTGCTAACAAT
GGCATCCCTCCACCCACTTCAAACCTTAACCAACTCATCTCAAGATTCAGCGCTCTTGGACTTTCCACCAAGGACTTGGTCGCCTTGTCCG
GTGGTCACACAATTGGACAAGCAAGGTGC
ACAAACTTCAGAGCCCGCATCTACAACGAGAGCAACATAGACACCGCATTTGCAAGGACAAGGCAACAAAGCTGCCCAAGAACATCAGGGTCAGGGGACAATAATCTTGCAACGCTTGAT
CTTCAAACTCCAACCGAATTCGACAACTACTACTTCAAGAATCTTGTTCAGAAGAAGGGTCTCCTCCACTCTGATCAGCAACTGTTCAATGGTGGGTCCACCGACTCCATTGTGCGTGGC
TACAGCACCAACCCGAGCTCCTTCTCCTCTGACTTCGCCGCCGCCATGATCAAGATGGGAGACATTAGTCCTCTCACTGGCTCCAACGGAGAAATCAGGAAGAATTGTAGAAGGATTAAC
TAA

Retrieve as FASTA