Entry information : GmPrx164 (Glyma07g36580.1)
Entry ID 8965
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2016-01-08 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-08 (Achraf Jemmat)
Peroxidase information: GmPrx164 (Glyma07g36580.1)
Name (synonym) GmPrx164 (Glyma07g36580.1)
Class Class III peroxidase    [Orthogroup: Prx028]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx164
start..stop
S start..stop
GmPrx285 607 0 14..332 14..322
MtPrx85 557 0 4..332 7..336
LjPrx40 541 0 14..332 12..333
EgrPrx131 471 1e-168 19..332 14..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 41931781..41932017 237 N° 2 41931265..41931456 192 N° 3 41930822..41930987 166 N° 4 41930331..41930734 404
complement(join(41930331..41930734,41930822..41930987,41931265..41931456,4193178 1..41932017))


exon

Literature and cross-references GmPrx164 (Glyma07g36580.1)
DNA ref. Phytozome 12:   Gm07 (41932017..41930331)
Protein sequence: GmPrx164 (Glyma07g36580.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (314)
PWM (Da):   %s   35789.69 (33694.5)  
PI (pH):   %s   4.42 (4.37) Peptide Signal:   %s   cut: 19 range:19-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQLVILCLLILKLTPAFATTLNDAYGDDSSGCPLGTDIYQYTCPEAEAIIFSWVEQAVSHDSRMAASLLRLHFHDCFVNGCDGSVLLDDTQDFVGEKTAGPNLNSLRGFEVIDQIKSELELVCPQTVSCADILATAARDSVLLSGGPIWEVQMGRKDGITASKNAANNNIPGPNSTVDVLVAKFENVGLTLKDMVALSGAHTIGKARCRTFSSRFQTSSNSESANANIEFIASLQQLCSGPDNSNTVAHLDLATPATFDNQYFVNLLSGEGLLPSDQALVNGNDQTRQIVETYVENPLAFFEDFKLSMLKMGSLASPTQTSGQIRRNCRTIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Incorrect prediction from phytozome (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAATTAGTAATATTGTGTCTACTGATACTCAAGCTCACTCCAGCCTTTGCAACCACCCTGAATGATGCCTATGGTGATGATAGTAGTGGCTGTCCATTAGGGACTGACATATACCAA
TACACTTGCCCTGAAGCTGAGGCCATTATCTTCTCTTGGGTGGAGCAGGCAGTGTCTCATGACTCAAGAATGGCAGCGTCACTTCTTAGGCTACATTTCCATGATTGCTTTGTCAAT
GCA
AGGCATTCTTTGCCTCCACATACTATCTTTTAGAGTAGATTACACTGACAAATTTTGTGAAATTGCACAAAATCTTTCTGTTTTTTTCTCTCTATACTAACTCCTTAACTGTTTGAAAAA
CATTGAACAGCATTATACTAACCCTTTGATTGTTTAAAAAGTATTACACCGTGTCCTCTTATAAGAAAAGTGGTTGTACAGGTTAAAAAACAAAGAAATTTGTGCAATCTCTCAAATCTT
AAGGATGCCAGTATAATTTACTCTATCTTTTGAAGGTTCTATAAATCCCATTAATGGTGTGATATTTTGTTGACATTTCAGGGTTGTGATGGTTCAGTCTTGCTAGATGACACACAGGAC
TTTGTTGGCGAGAAAACTGCGGGTCCAAATTTGAATTCACTCAGAGGATTCGAAGTAATTGACCAAATCAAATCCGAACTAGAACTAGTCTGTCCACAGACCGTCTCTTGTGCTGACATA
CTGGCAACTGCTGCCAGAGATTCAGTTCTTCTG
GTTTGTCATTGTTGCCTTCCTTCCTCGGCCTCCATTGTTTCTCAGTTATTCTAGAAATTAATTTTTATCCGCCGGAAAATGTAATGT
AAAATGTTTTATATTATCAACTAATAACGAGAATCATGATAAACATTACTTTTAAAATATTTACTGTTAAAGTCAATAAACTTTATCATACACGAGAATTTATGATTAATGACACTGAAA
AAAGTGCATACACTATTTTGTCCACTATTCTAGCTATCATGAATCATATTATTAAACTGCTGAGTTACAGTCAGGAGGTCCAATTTGGGAGGTGCAAATGGGAAGGAAAGATGGCATTAC
TGCTAGCAAGAATGCAGCAAATAATAACATCCCAGGTCCAAACTCCACTGTTGATGTGCTTGTAGCGAAGTTCGAGAATGTAGGCCTTACACTTAAAGATATGGTTGCCCTTTCAG
GTTA
ATCATCTTCACACTTTCTTATTCACATGCTATTAGAATTCTTTTCCATCATTGAGAAATTAACAAGATTAGCATTTTTTTCAGGTGCGCACACAATTGGTAAAGCTCGCTGCAGAACATT
TAGCTCGCGTTTTCAGACTAGTAGTAACTCAGAAAGTGCCAATGCTAACATTGAATTCATTGCATCATTGCAACAGCTATGCTCAGGACCAGATAATAGTAACACAGTTGCACATCTTGA
TTTGGCTACACCTGCTACTTTTGATAATCAATATTTTGTTAATCTTCTATCTGGGGAGGGATTGCTCCCATCAGACCAGGCTCTTGTGAATGGGAATGATCAGACACGACAGATTGTCGA
AACCTACGTGGAGAACCCATTAGCTTTCTTTGAGGACTTCAAGCTTTCTATGTTGAAAATGGGAAGCTTGGCATCACCAACTCAGACTAGTGGCCAGATTCGTAGGAACTGCCGAACTAT
TAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAATTAGTAATATTGTGTCTACTGATACTCAAGCTCACTCCAGCCTTTGCAACCACCCTGAATGATGCCTATGGTGATGATAGTAGTGGCTGTCCATTAGGGACTGACATATACCAA
TACACTTGCCCTGAAGCTGAGGCCATTATCTTCTCTTGGGTGGAGCAGGCAGTGTCTCATGACTCAAGAATGGCAGCGTCACTTCTTAGGCTACATTTCCATGATTGCTTTGTCAAT
GGT
TGTGATGGTTCAGTCTTGCTAGATGACACACAGGACTTTGTTGGCGAGAAAACTGCGGGTCCAAATTTGAATTCACTCAGAGGATTCGAAGTAATTGACCAAATCAAATCCGAACTAGAA
CTAGTCTGTCCACAGACCGTCTCTTGTGCTGACATACTGGCAACTGCTGCCAGAGATTCAGTTCTTCTG
TCAGGAGGTCCAATTTGGGAGGTGCAAATGGGAAGGAAAGATGGCATTACT
GCTAGCAAGAATGCAGCAAATAATAACATCCCAGGTCCAAACTCCACTGTTGATGTGCTTGTAGCGAAGTTCGAGAATGTAGGCCTTACACTTAAAGATATGGTTGCCCTTTCAG
GTGCG
CACACAATTGGTAAAGCTCGCTGCAGAACATTTAGCTCGCGTTTTCAGACTAGTAGTAACTCAGAAAGTGCCAATGCTAACATTGAATTCATTGCATCATTGCAACAGCTATGCTCAGGA
CCAGATAATAGTAACACAGTTGCACATCTTGATTTGGCTACACCTGCTACTTTTGATAATCAATATTTTGTTAATCTTCTATCTGGGGAGGGATTGCTCCCATCAGACCAGGCTCTTGTG
AATGGGAATGATCAGACACGACAGATTGTCGAAACCTACGTGGAGAACCCATTAGCTTTCTTTGAGGACTTCAAGCTTTCTATGTTGAAAATGGGAAGCTTGGCATCACCAACTCAGACT
AGTGGCCAGATTCGTAGGAACTGCCGAACTATTAACTAA

Retrieve as FASTA