Entry information : GmPrx166 (Glyma07g39290.1)
Entry ID 8966
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-26 (Christophe Dunand)
Peroxidase information: GmPrx166 (Glyma07g39290.1)
Name (synonym) GmPrx166 (Glyma07g39290.1)
Class Class III peroxidase    [Orthogroup: Prx039]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx166
start..stop
S start..stop
GmPrx324 644 0 1..327 1..327
MtPrx93 514 0 1..327 1..327
EglPrx85 426 3e-151 8..327 7..319
EgrPrx85 426 3e-151 8..327 7..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 43793569..43793790 222 N° 2 43793965..43794328 364 N° 3 43794417..43794814 398  
join(43793569..43793790,43793965..43794328,43794417..43794814)


exon

Literature and cross-references GmPrx166 (Glyma07g39290.1)
DNA ref. Phytozome 12:   Gm07 (43793569..43794814)
Protein sequence: GmPrx166 (Glyma07g39290.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328
PWM (Da):   %s   36484.18  
PI (pH):   %s   5.63
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEISFPWILVATMVMAMRPLSFRIKANQLSYDYYKFSCPNLESIVKSELLSLFLTDATAPAAFLRLMFHDCQVQGCDASILLDSNYLAHSHSSEMISSRNFGIRKRETIGQMKSILEEECPGQVSCADIIVLAAKESVSLSGGPHIEIPLGRKDSRTCSFHEADAKLPSPIITVDEFISIFMSIGMNIEESVSILGAHTLGIGHCFNIVGRLYDPRLGDKMDFALEASLRLACPTEIPLTNLTFVPNDMTPVIFDNQYYRDIMMGRGLFGIDSSISRDPRTAPFVMRFAMDQNYFFKAFSSAFVKLSSTNVLTDVQGDVRRQCNQVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 3).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAATATCTTTTCCTTGGATTCTGGTGGCCACAATGGTCATGGCAATGCGGCCACTTTCATTTCGCATAAAAGCAAACCAACTTTCTTACGACTACTACAAATTTTCATGCCCAAAC
TTGGAAAGCATAGTCAAGAGTGAGTTGCTAAGCTTATTCTTGACAGATGCTACTGCACCAGCTGCATTTCTCAGGCTCATGTTTCATGACTGCCAAGTTCAA
GTAAATGTGTTTCTTCTC
TCTTTTTGTCCCTTATATACTTTGCTCTTCACAGGCTTGCTTCACCAACTAGCATTATTGCAGAACATTTTCAAGACAAACCCAACCGTGTTCTTGTTTCATTAATTCAAGATTTATATA
TAAAGCCTTGTTGTTGTTGTGTTTATTTTCATGCAGGGATGTGATGCCTCAATTCTGTTGGACTCCAACTACCTAGCTCACAGTCACAGCTCTGAAATGATATCTTCAAGGAACTTTGGC
ATCAGAAAGCGCGAAACGATCGGCCAAATGAAGTCAATATTAGAAGAAGAATGTCCGGGACAGGTGTCTTGTGCAGATATCATTGTATTAGCTGCTAAGGAATCAGTGTCGCTCTCTGGA
GGACCACATATTGAGATCCCACTTGGAAGAAAAGACTCCAGAACTTGTAGTTTCCATGAGGCCGATGCTAAGCTTCCTTCACCAATAATAACGGTTGATGAATTTATATCCATTTTCATG
TCTATAGGAATGAACATCGAAGAGTCTGTTTCCATTTTAG
GTAATGCATGTCAACCTTAAAGAGGTGACACTATAAGGTGTTTAAAACTGTTAACTATTGATTTGTTATTGATTGTAACT
ATTGGTAGGCGCACATACACTAGGGATTGGACACTGCTTCAACATTGTTGGTAGATTGTATGATCCACGGCTAGGGGACAAGATGGATTTTGCGTTGGAAGCCTCTCTAAGACTAGCATG
CCCAACTGAGATTCCTTTGACAAACCTCACATTTGTGCCTAACGACATGACCCCAGTTATATTTGACAACCAGTATTACCGGGACATTATGATGGGGAGAGGCTTGTTTGGTATTGACTC
CAGCATTTCTAGAGATCCGCGAACAGCACCCTTTGTCATGCGGTTTGCTATGGATCAGAACTACTTCTTCAAGGCTTTCTCATCGGCATTTGTTAAACTTTCTTCTACCAATGTTCTCAC
AGATGTGCAGGGTGATGTCCGAAGGCAATGCAACCAGGTAAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAATATCTTTTCCTTGGATTCTGGTGGCCACAATGGTCATGGCAATGCGGCCACTTTCATTTCGCATAAAAGCAAACCAACTTTCTTACGACTACTACAAATTTTCATGCCCAAAC
TTGGAAAGCATAGTCAAGAGTGAGTTGCTAAGCTTATTCTTGACAGATGCTACTGCACCAGCTGCATTTCTCAGGCTCATGTTTCATGACTGCCAAGTTCAA
GGATGTGATGCCTCAATT
CTGTTGGACTCCAACTACCTAGCTCACAGTCACAGCTCTGAAATGATATCTTCAAGGAACTTTGGCATCAGAAAGCGCGAAACGATCGGCCAAATGAAGTCAATATTAGAAGAAGAATGT
CCGGGACAGGTGTCTTGTGCAGATATCATTGTATTAGCTGCTAAGGAATCAGTGTCGCTCTCTGGAGGACCACATATTGAGATCCCACTTGGAAGAAAAGACTCCAGAACTTGTAGTTTC
CATGAGGCCGATGCTAAGCTTCCTTCACCAATAATAACGGTTGATGAATTTATATCCATTTTCATGTCTATAGGAATGAACATCGAAGAGTCTGTTTCCATTTTAG
GCGCACATACACTA
GGGATTGGACACTGCTTCAACATTGTTGGTAGATTGTATGATCCACGGCTAGGGGACAAGATGGATTTTGCGTTGGAAGCCTCTCTAAGACTAGCATGCCCAACTGAGATTCCTTTGACA
AACCTCACATTTGTGCCTAACGACATGACCCCAGTTATATTTGACAACCAGTATTACCGGGACATTATGATGGGGAGAGGCTTGTTTGGTATTGACTCCAGCATTTCTAGAGATCCGCGA
ACAGCACCCTTTGTCATGCGGTTTGCTATGGATCAGAACTACTTCTTCAAGGCTTTCTCATCGGCATTTGTTAAACTTTCTTCTACCAATGTTCTCACAGATGTGCAGGGTGATGTCCGA
AGGCAATGCAACCAGGTAAACTAA

Retrieve as FASTA