Entry information : Sb2CysPrx (Sobic.004G168500.1 [2.1] / Sb04g021990 [1.4])
Entry ID 897
Creation 2008-10-22 (Christophe Dunand)
Last sequence changes 2011-08-12 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: Sb2CysPrx (Sobic.004G168500.1 [2.1] / Sb04g021990 [1.4])
Name (synonym) Sb2CysPrx (Sobic.004G168500.1 [2.1] / Sb04g021990 [1.4])
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Callus
Seedlings
Inducers Nitrogen starvation
Salt stress
Repressor N/D
Best BLASTp hits
Perox score E-value Sb2CysPrx
start..stop
S start..stop
Zm2CysPrx02 520 0 1..260 1..260
Zm2CysPrx01 510 0 1..260 1..260
Ta2CysPrx 437 1e-157 1..260 1..258
Os2CysPrx 429 3e-154 2..260 3..261
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 51207389..51207577 189 N° 2 51207688..51207762 75 N° 3 51207908..51207989 82 N° 4 51208079..51208158 80
N° 5 51209744..51209869 126 N° 6 51209986..51210099 114 N° 7 51210761..51210877 117  
join(51207389..51207577,51207688..51207762,51207908..51207989,51208079..51208158 ,51209744..51209869,51209986..51210099,51210761..51210877)


exon

Literature and cross-references Sb2CysPrx (Sobic.004G168500.1 [2.1] / Sb04g021990 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 11:   chromosome_4 (51207389..51210877)
Cluster/Prediction ref. UniGene:   Sbi.3994
Protein sequence: Sb2CysPrx (Sobic.004G168500.1 [2.1] / Sb04g021990 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   260
PWM (Da):   %s   27951.47  
PI (pH):   %s   6.54
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACSFAAATTVSSAPTPASRPLAAAPQSVSVARSAVATAARPLRLAASRSARATRLVARAGGVDDLPLVGNKAPDFEAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRYEEFEKLNTEVLGVSIDSFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKAFGVLIPSQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETMRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKGSKEYFAAI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 6 introns) and 60 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTGCTCCTTCGCCGCCGCCACCACCGTCTCTTCCGCCCCCACCCCGGCCTCTAGGCCCCTCGCCGCTGCCCCGCAGTCCGTCTCCGTCGCCCGCTCCGCGGTCGCCACCGCCGCC
AGGCCGCTCCGCCTCGCCGCCTCCAGATCCGCGCGGGCCACCAGACTCGTCGCCCGCGCCGGCGGCGTC
GTAAGTTCTCTCGCGTCTTGCCTCGCCTTACCGTACTACGGGTTTGCTTCT
CACCCCCTTCTTCTTTGCACTCACGGCTCTCGCCCTTGTGCCTCTGCTCTGCTCTGTAGGATGACTTGCCGCTGGTCGGGAACAAGGCTCCAGACTTCGAGGCCGAGGCTGTGTTCGACC
AGGAGTTCATCAAC
GTATGTGCACCTCTCTCTCTCCGCGCAATCTCGCGTGGTTTATGTATGCTGTGGCAGCAGAACTCTGAAATGTTTCGTCCTCTCAAATTGCTCCTAAGACCCTTTT
ATGTGGCTGGCGATGACATTGCTCTTTGTGCTTTTGCAGGTGAAGCTCTCTGATTACATTGGGAAGAAGTACGTCATTCTGTTCTTCTACCCCTTGGATTTCACCTTCGTCTGCCCGACC
G
GTGAGGATAAAACATTAGCATTAGTATCAACAAGACACGTTTGGAGTGGGTCTACGAGATTCTGATAAACTAACGCCCGGTACTTGTAGAGATTACTGCCTTCAGTGATAGATACGAGG
AATTCGAGAAGTTGAACACTGAGGTTCTTGGCGTCTCCATTGACAGTGTG
GTATGTTATAATGCCCTGGTATTCCATGATATGATAGCATCTGTCAGTATGAATCAGTCTGTCAATTGTT
CTTAAGGATAAGTGAGTGTAGTTGACATCTGATGCCTCCACTGTTCGTACGGGGATTGTTCTCTCATTTGTCATATTCGTAGTTAGCTGTTGAAGTACATTTCAGCTTTGATATGTGCTA
GCTCATAACTGAAATAGAAATATTATGGTTGAACTGCTCATATAATGAGAAATTCATGTGCTACTTCTAGGTTATCTTTGGAGCACAACTGCTGTACTTGTATGTATGGCTCTTGAGCAG
TCACATTATTTCTAAAATTAATTGTGGAAATTATGTTTATGTGGAGTTAGAGAAAAGTAGTTATACAAATACACAATATTCTATAACAGTAAGGTAGTCGCTGTGTAAGGGTGGGGCAGG
GGTTCAGGGGTTTTCTCGATCTGTGTGAGAAGATCTTCTTAAGCCGGAATACCCTGGGACTGTCTAGCCACCGTGGATTGAGTTATTTTTTTATAACAGTAAGGTAGTGTTTCCTTTACA
CTTGCCGGTTTCAATATTTGGCAAAGTAGTATGACCACACATTCTGCTTTTTTTTCTCATGGTGAAAGATACGTGCTGCGCATTATCAATGTAACTATTAATAGAAAAAACCATCTACAT
GAACATAACAGCAATGACAGTAGGGATGAGAACAGTCGGAATGGTACTATAATACAGAATCTGAAAGCGGTTGGTGCCGGATTTTCCCCTTTTTATCAAAATAAGTAATGAAGAAAATGG
TTGTGATAAAATCACAAAATGTCAACTTTCATGTTTTGATAGAAACGGAAATGTTATGATAATACGGAAAACGATATACCTGCTTTCACCTCTTAGTGACACGTCACTATCCAATATTTA
TTTCCAGATTTTCTATTGGGACTAAGAACTCACATTGCACTTGAGGCCTTAAATTTAACCTTTGTTGGTCCAAAGAAAATCTCTTCTTAGCTTCATAATCTTATTAAATTGATCATTTCT
GTTCGCTAAAGTACTTTACAATTACAAATCTTTGGAGAACTGCATAGTCCCTCCATTTTTATTTTTTAAATATGCCCCATTGAGTTTTTACTATAATTTTGACCAACAATATTATTTAAT
TACTTAGATAAGTAAAGTGAAAACTAAATCAGTTCTAAAGTCAAATGTTTATAGAAGAGACAAATAGTCAAATAAATAAAAGAGTCAAAGGTTAAACAGAGGAGTACTATTAAAAATGCC
CTAATGACTTGTATATTTGAAGTCTTTATACAGCTATGCTTGTATTTGTTATTACTCCCTCTGTTCCAAATTATAGGTTGTCTTGGCTTTTCTAATATCTAGACATAGCCTATATCTAGG
TGCATAGCAAAAGCTATTTACCTAAAAAAACCAAAACGACCTATAATTTGGGACAGAGGGAATACCTTTTTATATCATTGAATGTATGTGGTCAAAAGTAGAAATCTTGACATAAATAGA
TCTTGGGTTTTGGTTACTGTGATTTCATCATAATCATAACTGTTGTTAATTGCTTTAGTGTTTGTTTGGATGCAGTTCTCCCACCTTGCATGGGTGCAGACAGACAGGAAGTCTGGTGGG
CTTGGCGATCTTAAATACCCACTTATTTCTGATGTCACCAAATCAATTTCAAAGGCCTTTGGTGTTCTGATCCCTAGCCAG
GTTTTTTTTTTCAACCACTGGATATTCTTCTCCAGATTC
TAACCCTGTGGAGTCCTTTTGTTTTCCGTATTATGTTTCTGTTTGTTGCTCTCTATATCTGAATGTTCTTTGGGCAGGGTATTGCTCTGAGAGGACTGTTCATCATTGACAAGGAGGGAG
TGATTCAGCACTCTACCATTAACAACCTTGCCATTGGTCGTAGTGTGGATGAGACCATGAGGACCCTTCAG
GTATGTTCTATGTTGGTCGTGCTACATTTCTGATAGGCAGTTGCTCTGG
ACTTCAGAAATAAGAAGTTTTCTGTGCTGTTACTTAAAACCTAAAGTAAAATGAATATGCCTTTTGTGTTCATGGTGTTTGTGATACACAACTTGAACAAGATTCAACACTGGTGTGCAT
TTTACATGATGAATTGTTTGTCAACACTTGACAGTGCAATATAGTTCTCCATTTGCAGGGACAAAATAAACTGTTTCTAACCTTTAAATCATACTCTAATCCAAATGCTTTAAAATTACA
GAAGAATGACTGAAAATATGTACATTATTTATGTGACCTACTTTGGCATTAGTGTACAAGGCCATTTTACTATAGTACTATACTAAATATAACTGTCAAAGTACTACACATACCACTTTT
CATAGGGCAAGATGCATCATAGCAAGCATATATGGAAACAAGTGAGGCTCTTGATATGGGATGACGTTATGTAGTTTCACAATGAAAAATAAGCATAATCCCATGATTACAATTGTGGTA
CATCATTTGGGCATTTTGCTGAGCTGGTTTACGCCCTACCCAGTTACATAGCTGCTTTTGCCATTTTATACAGTCCACCGATAACAATCAGGAGAATATTGAAGTTGACATCTCATTTCA
ATGTTTCACCAGGCATTGCAGTACGTCCAGGAGAACCCAGACGAGGTGTGCCCGGCCGGCTGGAAGCCAGGGGAGAAGTCGATGAAGCCCGACCCCAAGGGAAGCAAAGAGTACTTCGCG
GCCATCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTGCTCCTTCGCCGCCGCCACCACCGTCTCTTCCGCCCCCACCCCGGCCTCTAGGCCCCTCGCCGCTGCCCCGCAGTCCGTCTCCGTCGCCCGCTCCGCGGTCGCCACCGCCGCC
AGGCCGCTCCGCCTCGCCGCCTCCAGATCCGCGCGGGCCACCAGACTCGTCGCCCGCGCCGGCGGCGTC
GATGACTTGCCGCTGGTCGGGAACAAGGCTCCAGACTTCGAGGCCGAGGCT
GTGTTCGACCAGGAGTTCATCAAC
GTGAAGCTCTCTGATTACATTGGGAAGAAGTACGTCATTCTGTTCTTCTACCCCTTGGATTTCACCTTCGTCTGCCCGACCGAGATTACTGCCTTC
AGTGATAGATACGAGGAATTCGAGAAGTTGAACACTGAGGTTCTTGGCGTCTCCATTGACAGTGTG
TTCTCCCACCTTGCATGGGTGCAGACAGACAGGAAGTCTGGTGGGCTTGGCGAT
CTTAAATACCCACTTATTTCTGATGTCACCAAATCAATTTCAAAGGCCTTTGGTGTTCTGATCCCTAGCCAG
GGTATTGCTCTGAGAGGACTGTTCATCATTGACAAGGAGGGAGTGATT
CAGCACTCTACCATTAACAACCTTGCCATTGGTCGTAGTGTGGATGAGACCATGAGGACCCTTCAG
GCATTGCAGTACGTCCAGGAGAACCCAGACGAGGTGTGCCCGGCCGGCTGGAAG
CCAGGGGAGAAGTCGATGAAGCCCGACCCCAAGGGAAGCAAAGAGTACTTCGCGGCCATCTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCAGACACGT CCCTATTTAA AACCTCCTCG CTCACTCAGC CATAGCCATC CCCAACACCC CCGGAAAGGA AACCCATCAC ACCAAATCCC CAACCCCAAA CCCCCAATCC ACCCTCATCC  ACTCCGGGCG GCCATGGCCT GCTCCTTCGC CGCCGCCACC ACCGTCTCTT CCGCCCCCAC CCCGGCCTCT AGGCCCCTCG CCGCTGCCCC GCAGTCCGTC TCCGTCGCCC GCTCCGCGGT  CGCCACCGCC GCCAGGCCGC TCCGCCTCGC CGCCTCCAGA TCCGCGCGGG CCACCAGACT CGTCGCCCGC GCCGGCGGCG TCGATGACTT GCCGCTGGTC GGGAACAAGG CTCCAGACTT  CGAGGCCGAG GCTGTGTTCG ACCAGGAGTT CATCAACGTG AAGCTCTCTG ATTACATTGG GAAGAAGTAC GTCATTCTGT TCTTCTACCC CTTGGATTTC ACCTTCGTCT GCCCGACCGA  GATTACTGCC TTCAGTGATA GATACGAGGA ATTCGAGAAG TTGAACACTG AGGTTCTTGG CGTCTCCATT GACAGTGTGT TCTCCCACCT TGCATGGGTG CAGACAGACA GGAAGTCTGG  TGGGCTTGGC GATCTTAAAT ACCCACTTAT TTCTGATGTC ACCAAATCAA TTTCAAAGGC CTTTGGTGTT CTGATCCCTA GCCAGGGTAT TGCTCTGAGA GGACTGTTCA TCATTGACAA  GGAGGGAGTG ATTCAGCACT CTACCATTAA CAACCTTGCC ATTGGTCGTA GTGTGGATGA GACCATGAGG ACCCTTCAGG CATTGCAGTA CGTCCAGGAG AACCCAGACG AGGTGTGCCC  GGCCGGCTGG AAGCCAGGGG AGAAGTCGAT GAAGCCCGAC CCCAAGGGAA GCAAAGAGTA CTTCGCGGCC ATCTAGACTC CCCGTCATTG AGAAGCTTTG CTACTCTATC ATGGTGCCTG  TTAAGTGCCC CAGCGGTAGG TCCTTGTGGA GTTTTGCGGA GCTCGCGTTT TGACATGCCT TTGTGCCTTG AACCGAGTGT GCTAGCCCTT GTGCTGTTGT GCATCCCGAT TGAGTGCTGT  TCTTTGCCAC TTCGTTTAAT TTTTCACCTG ACGAATAAGG TTCATTTGGC ACGTGATTGA GAGTTCACGC TTCTGGTGTA GTTTGCTGGG CTTCTGTTTG TAGCATTGTC TGGTAAGCTT 
CGCGTCGATG CTGATA 

Retrieve as FASTA