Entry information : GmPrx181 (Glyma09g05340.1)
Entry ID 8973
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-11-28 (Qiang Li)
Peroxidase information: GmPrx181 (Glyma09g05340.1)
Name (synonym) GmPrx181 (Glyma09g05340.1)
Class Class III peroxidase    [Orthogroup: Prx036]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx181
start..stop
S start..stop
GmPrx64 615 0 1..345 1..342
MtPrx100 543 0 1..345 1..343
LjPrx50 519 0 19..345 19..350
PpePrx71 477 1e-170 22..345 31..351
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4138807..4138918 112 N° 2 4138949..4139115 167 N° 3 4139464..4139810 347 N° 4 4140211..4140614 404
join(4138807..4138918,4138949..4139115,4139464..4139810,4140211..4140614)


exon

Literature and cross-references GmPrx181 (Glyma09g05340.1)
DNA ref. Phytozome 12:   Gm09 (4138807..4140614)
Protein sequence: GmPrx181 (Glyma09g05340.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   345 (323)
PWM (Da):   %s   37828.92 (35545.7)  
PI (pH):   %s   5.59 (5.59) Peptide Signal:   %s   cut: 22 range:22-344
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSNSFLSLLILLVLYIFSASAQPYEDYDDKSSLYPTKTLDETTFDNLLSFGYYRKTCPQFESILHNKVKEWILKDYTLAASLMRLHFHDCSVRGCDGSILLKHDGSERTAHASKTLRGFEVVDDIKAELEKQCPKTVSCADILTAAARDATFELxGGPYWAVPYGGKNGxKVSIAKEADMVPMGHENITSLIEFFQSxGA*QVLDLVVLSGAHTIGRISCGSIQYRLYNNQGTGKPDPTLDPKYVNFLQSKCRWASEYVDLDATTPKTFDNVYYINLQKKMGLLSTDQLLYSDPRTSPLVSALIASHSVFEHQFAVSMGKLGIVDVLTDQDEGEIRTNCNFVNAY

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (frame shift due to probable sequencing errors).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAAACTCTTTCCTCTCATTGCTTATTCTCTTGGTTCTTTACATTTTTTCAGCCTCAGCCCAACCTTATGAAGACTATGACGATAAGTCATCCCTTTACCCCACAAAAAGTGACACT
GTCTTCTCTCTCGAAGTCCCAACATTAGATGAAACCACCTTTGATAATCTCCTATCCTTTGGTTACTACCGTAAAACCTGCCCCCAATTCGAGTCCATCCTACACAACAAAGTCAAAGAA
TGGATCCTGAAGGACTACACTCTAGCAGCTAGTCTCATGAGGCTCCACTTCCATGATTGCTCTGTCAGG
GTACATATTAAGCACTACTCATCCCTATGTGTCCATTTGTTTCATATTTTT
GTAGAATGATTTTTTATATTTAAAAATGAAATAAAAAAATACTTTGTGGATATATATAAGAATAAATAATTCTTGTTAGTGATGGGTTATGATTTATATAAGGATCAATTCATATAAGAC
GTAATATCTTAGCTATCTAAATGTGGGTTATAATCCTATTAAAGGGTGAAGTTTCTCTACTGAGATTTGAGATTAGTCGTAGGTAAATTAGTGAATACTTTGTAGCAATATGATAACTCA
AAAAATGTGAGTTATGATTTTGCACTATATTCATTTGGGCTTTTTCTATTTATGCAGGGATGTGATGGTTCCATTCTGTTGAAGCATGATGGAAGTGAGAGGACAGCACATGCTAGCAAG
ACACTGAGAGGGTTTGAAGTGGTGGATGATATCAAGGCAGAGTTAGAGAAACAGTGCCCCAAGACTGTGTCTTGTGCTGACATTCTCACTGCTGCTGCAAGGGATGCCACGTTTGAGTTA
ANNGGTGGGCCTTATTGGGCTGTTCCTTATGGTGGGAAGAATGGGGANAAGGTATCCATTGCTAAGGAAGCTGATATGGTGCCTATGGGCCATGAAAACATTACTTCCTTGATTGAGTTT
TTCCAATCCANNGGGGCATGACAAGTGCTTGACTTGGTTGTTCT
CTCAGGTAAATATAAACTAAATGAAGTATATTTAAGTTGAATTTAATTACAACGGTCATGTAGAGTAAAATAGTTG
AGTTTATAATAAATATTTTAAATGTCATATTCATATCTAAAATAATTTTTAATTAGTTGACAATATAATTATATTAAAATTTATAATTTAATGATCACTGATAATATATAATTAATATGA
TGATTTATATAAATTTTAAGGTAATTAATTATTATAAAAATTAATAAACTTATCATACATAATAATTTATAATTAAATGTAAAACTACTTTTATAGTACATAATCTAATTTCAACTTTTA
TAGTTTGGATGCAAATGTGCAACATTATCCAACTTATTTTAAAATGTTTCACTGATTGTTTGCTTTATATATGTAATGATTGTGTTCAGGGGCTCATACCATTGGAAGAATTTCATGTGG
CTCCATTCAATACAGGCTGTACAACAACCAAGGAACAGGCAAACCAGACCCAACCCTAGATCCCAAGTATGTAAACTTCTTGCAAAGTAAGTGTAGATGGGCCTCAGAGTATGTGGATCT
TGATGCTACAACACCAAAGACCTTTGACAATGTTTACTACATTAATCTCCAAAAGAAAATGGGGTTGTTATCTACTGATCAGTTGCTATACTCTGATCCAAGGACTTCTCCCCTTGTTTC
TGCATTGATTGCTTCTCACTCAGTTTTTGAGCACCAGTTTGCTGTGTCCATGGGAAAGCTTGGCATTGTTGATGTTCTCACAGACCAGGATGAAGGAGAAATCAGGACCAACTGCAATTT
TGTCAATG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAAACTCTTTCCTCTCATTGCTTATTCTCTTGGTTCTTTACATTTTTTCAGCCTCAGCCCAACCTTATGAAGACTATGACGATAAGTCATCCCTTTACCCCACAAAAACATTAGAT
GAAACCACCTTTGATAATCTCCTATCCTTTGGTTACTACCGTAAAACCTGCCCCCAATTCGAGTCCATCCTACACAACAAAGTCAAAGAATGGATCCTGAAGGACTACACTCTAGCAGCT
AGTCTCATGAGGCTCCACTTCCATGATTGCTCTGTCAGG
GGATGTGATGGTTCCATTCTGTTGAAGCATGATGGAAGTGAGAGGACAGCACATGCTAGCAAGACACTGAGAGGGTTTGAA
GTGGTGGATGATATCAAGGCAGAGTTAGAGAAACAGTGCCCCAAGACTGTGTCTTGTGCTGACATTCTCACTGCTGCTGCAAGGGATGCCACGTTTGAGTTAANNGGTGGGCCTTATTGG
GCTGTTCCTTATGGTGGGAAGAATGGGGANAAGGTATCCATTGCTAAGGAAGCTGATATGGTGCCTATGGGCCATGAAAACATTACTTCCTTGATTGAGTTTTTCCAATCCANNGGGGCA
TGACAAGTGCTTGACTTGGTTGTTCT
TTCAGGGGCTCATACCATTGGAAGAATTTCATGTGGCTCCATTCAATACAGGCTGTACAACAACCAAGGAACAGGCAAACCAGACCCAACCCTA
GATCCCAAGTATGTAAACTTCTTGCAAAGTAAGTGTAGATGGGCCTCAGAGTATGTGGATCTTGATGCTACAACACCAAAGACCTTTGACAATGTTTACTACATTAATCTCCAAAAGAAA
ATGGGGTTGTTATCTACTGATCAGTTGCTATACTCTGATCCAAGGACTTCTCCCCTTGTTTCTGCATTGATTGCTTCTCACTCAGTTTTTGAGCACCAGTTTGCTGTGTCCATGGGAAAG
CTTGGCATTGTTGATGTTCTCACAGACCAGGATGAAGGAGAAATCAGGACCAACTGCAATTTTGTCAATG

Retrieve as FASTA