Entry information : AruPrx01-1 (HRPC1A / PrxC1A / HRAHRPCA / HRP_C1A)
Entry ID 90
Creation 2006-09-05 (Christophe Dunand)
Last sequence changes 2014-05-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-06-12 (Christophe Dunand)
Peroxidase information: AruPrx01-1 (HRPC1A / PrxC1A / HRAHRPCA / HRP_C1A)
Name (synonym) AruPrx01-1 (HRPC1A / PrxC1A / HRAHRPCA / HRP_C1A)
Class Class III peroxidase    [Orthogroup: Prx035]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Armoracia
Organism Armoracia rusticana (horseradish)    [TaxId: 3704 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AruPrx01-1
start..stop
S start..stop
BstrPrx03 650 0 1..353 1..353
AtPrx34 645 0 1..353 1..353
AlyPrx34-2 644 0 15..353 17..355
BrPrx34-1Ab_other 642 0 7..353 3..349
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 534..764 231 N° 2 1115..1306 192 N° 3 1826..1994 169 N° 4 2079..2548 470
join(534..764,1115..1306,1826..1994,2079..2548)


exon

Literature and cross-references AruPrx01-1 (HRPC1A / PrxC1A / HRAHRPCA / HRP_C1A)
Literature REFERENCE 1 Fujiyama,K. et al Structure of the horseradish peroxidase isozyme C genes.
REFERENCE 2 Fujiyama,K., Takemura,H., Shibayama,S., Kobayashi,K., Choi,J.K., Shinmyo,A., Takano,M., Yamada,Y. and Okada,H. Structure of the horseradish peroxidase isozyme C genes. Eur. J. Biochem. 173 (3), 681-687 (1988).
REFERENCE 3 Naatsaari,L., Krainer,F.W., Schubert,M., Glieder,A. and Thallinger,G.G. Peroxidase gene discovery from the horseradish transcriptome. BMC Genomics 15 (1), 227 (2014)
Protein ref. GenBank:   CAA00083.1 UniProtKB:   K7ZWW6   P00433
DNA ref. GenBank:   HE963800.1   M37156.1
Protein sequence: AruPrx01-1 (HRPC1A / PrxC1A / HRAHRPCA / HRP_C1A)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   353 (323)
PWM (Da):   %s   38619.39 (35417.8)  
PI (pH):   %s   5.94 (5.70) Peptide Signal:   %s   cut: 31 range:31-353
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHFSSSSTLFTCITLIPLVCLILHASLSDAQLTPTFIDNSCPNVSNIVRDTIVNELRSDPRIAASILRLHFHDCFVNGCDASILLDNTTSFRTEKDAFGNANSARGFPVIDRMKAAVESACPRTVSCADLLTIAAQQSVTLAGGPSWRVPLGRRDSLQAFLDLANANLPAPFFTLPQLKDSFRNVGLNRSSDLVALSGGHTFGKNQCRFIMDRLYNFSNTGLPDPTLNTTYLQTLRGLCPLNGNLSALVDFDLRTPTIFDNKYYVNLEEQKGLIQSDQELFSSPNATDTIPLVRSFANSTQTFFNAFVEAMDRMGNITPLTGTQGQIRLNCRVVNSNSLLHDMVEVVDFVSSM

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATTTCTCTTCTTCTTCTACTTTGTTCACTTGTATAACCTTAATCCCATTGGTATGTCTTATTCTTCATGCTTCTTTGTCTGATGCTCAACTTACCCCTACCTTCATCGACAATTCA
TGTCCTAATGTCTCTAACATCGTACGGGATACTATTGTCAATGAGCTAAGATCAGACCCTCGTATTGCCGCGAGCATCCTTCGTCTTCACTTCCACGACTGCTTTGTTAAT
GTAAATTAC
TACTTTTCATATTTCTATTTCGTTACGAATTATTATATGTTTCATGTAACTGATTTTTAAATGCTTATCTATTCATACTGTCTAATTACATTTATCATTTGAATTTGATTATTAAATCAG
TTTTAATGTGATTAATATAAATTTTAAAAAAATGTGATTAATATATAAACATTTTGATGATAAAATTTTTAATTTGTTTATTTTTCTTTTTTTTTACTGAATAAAATTTTTTTTAGTGGA
TGACAAAAATGTTACATTGTTGCCGTGGTAAAGATTCAACTGTATATGGATGTAATACATTGAATAATAATTTATTAAATGATATATTGGATTTTTGAAAGGGTTGTGACGCATCGATCT
TGTTAGACAACACAACATCATTTCGAACAGAGAAAGATGCGTTTGGAAACGCAAACTCGGCAAGAGGATTTCCAGTGATTGATAGAATGAAAGCCGCGGTGGAGAGTGCATGCCCAAGAA
CCGTTTCATGCGCAGATTTGCTCACCATTGCAGCTCAACAATCTGTCACTTTG
GTATGCTCCATTGATCCCACTAACTTTTATTCATTACAATTATTGCTTTTAATTTTAATATATCAAA
TAGTCACTTTACATATCAACACGGCAACCTAAGTTTAGAAAAACAAAAATCGGGATATTTTTAGCTGTTTGAGAACGACATGGAAATTATTTAGTTGTTTCAGAAGGGTCACAATCAATA
TATAGTATCAACTTTCCAATCATATGACTAGTATTCAAAATTAATCGGGAGATATTTGAAACGCGTGGTCCCCGTAGAGAAAACTTGAAATGTTTAATATCACTGAAAAAAATTAATCTC
ATTAACAAGAATATACTTACTTGGCAATACTACGTTTTTAGTTAACCAAAAAGAATGGTTTTCATATTTTTCAAGAAAGAGTGGAGACTTAAAAACTTCACTTCAAGCATATATATCATC
AATGAATTTAAATTACACATATTTTTCTCTTAACACATTGAAACTTCTAAATGAGGAAAATAATAATCAAAACAAAATGGTTATTATTATAGGCGGGAGGTCCTTCTTGGAGAGTTCCTT
TGGGCAGAAGAGATAGCTTACAAGCATTTCTGGATCTTGCTAATGCAAATCTTCCAGCTCCATTCTTCACACTTCCACAACTTAAAGACAGCTTTAGAAATGTTGGCCTCAACCGTTCTT
CTGATCTCGTTGCACTGTCCG
GTAATTAACAAAAATATATTAAACACACCATTTGATATAGTTGTATTTAGTGAGTTTATTAAAGATCTCTCTTTCTTTTGTTAGGGGGCCACACATTTG
GTAAAAATCAGTGTCGGTTTATTATGGACAGATTATACAACTTCAGCAACACCGGTTTACCCGATCCTACTCTCAACACTACTTATCTCCAAACTCTTCGTGGACTATGTCCCCTCAATG
GTAATCTAAGCGCTTTGGTGGATTTTGATCTACGTACGCCAACGATTTTTGACAACAAATACTATGTGAATCTCGAAGAGCAAAAAGGACTTATCCAAAGCGACCAAGAGTTGTTCTCTA
GCCCCAATGCCACTGACACAATCCCTTTGGTGAGATCATTTGCTAATAGCACACAAACATTCTTCAATGCGTTTGTGGAGGCGATGGATAGGATGGGAAACATTACACCTCTTACAGGAA
CTCAAGGACAGATCAGGTTGAATTGTAGGGTGGTGAACTCCAACTCTCTACTCCATGATATGGTGGAGGTCGTTGACTTTGTTAGCTCTATGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATTTCTCTTCTTCTTCTACTTTGTTCACTTGTATAACCTTAATCCCATTGGTATGTCTTATTCTTCATGCTTCTTTGTCTGATGCTCAACTTACCCCTACCTTCATCGACAATTCA
TGTCCTAATGTCTCTAACATCGTACGGGATACTATTGTCAATGAGCTAAGATCAGACCCTCGTATTGCCGCGAGCATCCTTCGTCTTCACTTCCACGACTGCTTTGTTAAT
GGTTGTGAC
GCATCGATCTTGTTAGACAACACAACATCATTTCGAACAGAGAAAGATGCGTTTGGAAACGCAAACTCGGCAAGAGGATTTCCAGTGATTGATAGAATGAAAGCCGCGGTGGAGAGTGCA
TGCCCAAGAACCGTTTCATGCGCAGATTTGCTCACCATTGCAGCTCAACAATCTGTCACTTTG
GCGGGAGGTCCTTCTTGGAGAGTTCCTTTGGGCAGAAGAGATAGCTTACAAGCATTT
CTGGATCTTGCTAATGCAAATCTTCCAGCTCCATTCTTCACACTTCCACAACTTAAAGACAGCTTTAGAAATGTTGGCCTCAACCGTTCTTCTGATCTCGTTGCACTGTCCG
GGGGCCAC
ACATTTGGTAAAAATCAGTGTCGGTTTATTATGGACAGATTATACAACTTCAGCAACACCGGTTTACCCGATCCTACTCTCAACACTACTTATCTCCAAACTCTTCGTGGACTATGTCCC
CTCAATGGTAATCTAAGCGCTTTGGTGGATTTTGATCTACGTACGCCAACGATTTTTGACAACAAATACTATGTGAATCTCGAAGAGCAAAAAGGACTTATCCAAAGCGACCAAGAGTTG
TTCTCTAGCCCCAATGCCACTGACACAATCCCTTTGGTGAGATCATTTGCTAATAGCACACAAACATTCTTCAATGCGTTTGTGGAGGCGATGGATAGGATGGGAAACATTACACCTCTT
ACAGGAACTCAAGGACAGATCAGGTTGAATTGTAGGGTGGTGAACTCCAACTCTCTACTCCATGATATGGTGGAGGTCGTTGACTTTGTTAGCTCTATGTGA

Retrieve as FASTA