Entry information : GmPrx285 ( Glyma17g04030.1)
Entry ID 9014
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2016-02-04 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-04 (Achraf Jemmat)
Peroxidase information: GmPrx285 ( Glyma17g04030.1)
Name (synonym) GmPrx285 ( Glyma17g04030.1)
Class Class III peroxidase    [Orthogroup: Prx028]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx285
start..stop
S start..stop
GmPrx164 630 0 1..322 1..332
MtPrx85 538 0 4..322 7..336
LjPrx40 526 0 14..322 12..333
EguPrx131 457 2e-163 19..322 14..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2668903..2669139 237 N° 2 2669493..2669684 192 N° 3 2669952..2670117 166 N° 4 2670363..2670736 374
join(2668903..2669139,2669493..2669684,2669952..2670117,2670363..2670736)


exon

Literature and cross-references GmPrx285 ( Glyma17g04030.1)
DNA ref. Phytozome 12:   Gm17 (2668903..2670736)
Protein sequence: GmPrx285 ( Glyma17g04030.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (304)
PWM (Da):   %s   34679.32 (32698.1)  
PI (pH):   %s   4.51 (4.45) Peptide Signal:   %s   cut: 19 range:19-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQLVLLCLLILKLTPAFATTPNDAYGGDSSGCPLGTDIYQYTCPEAEAIIFSWVEQAVSQDSRMAASLLRLHFHDCFVNGCDASVLLDDTQDFVGEKTAGPNLNSLRGFEVIDQIKSELELVCPQTVSCADILATAARDSVLLSGGPIWEVQMGRKDGITASKNAANNNIPGPNSTVDVLVAKFENVGLTLKDMVALSGAHTIGKARCRTFRSRLQTSSNIDFVASLQQLCSGPDTVAHLDLATPATFDNQYFVNLLSGEGLLPSDQALVNGNDQTRQIVENYVENPLAFFEDFKLSMLKMGSLASPTQTNAQIRRNCRTIN

Retrieve as FASTA  
Remarks Complete sequence from genomic. No EST. Incorrect prediction from Phytozome (incorrect splicing of exon1-intron1 and last 3' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAATTAGTACTATTGTGTCTACTGATACTGAAGCTCACTCCAGCCTTTGCAACCACCCCGAATGATGCCTATGGTGGTGATAGTAGTGGCTGTCCATTAGGGACTGACATATACCAA
TACACTTGCCCTGAAGCTGAGGCCATCATATTCTCTTGGGTGGAGCAGGCAGTGTCTCAAGACTCAAGAATGGCAGCCTCACTTCTTAGGCTACATTTCCATGATTGCTTTGTTAAT
GCA
AGACATTCTTAATTTTCCTCCACAAGTTATCTTTTAGAGTAAAATTACATTGACAGCTCCTGAAATTTTGTGAAATTGCTCAAAATCTTTCCGTTTTTTCCATCTCTATACTAACTAACT
CCTTAACTGTTTGAAAAAACATTTGCACAACATTATACATTATACTAGCCCTTTAATTGTTTAAAAGATATTACACCCTGTCCTTTTATAAGAAAAAGTGATTGAAAATGTTAAAAAAAC
AAAGAGATTTGTGCAATCTCTCAAATCTTAAGGATGTCAACATAATTTGCTCTATCTTTTAAAAGTTCTATAAATTCAATTAACGGTATAATATTTTGTTGACATTTCAGGGTTGTGATG
CTTCAGTCTTGCTAGATGACACACAGGACTTTGTTGGTGAGAAAACTGCGGGTCCAAATTTGAATTCCCTGAGAGGATTCGAAGTAATCGACCAAATCAAATCCGAACTGGAACTAGTCT
GTCCACAGACTGTCTCTTGTGCTGACATACTCGCAACTGCTGCCAGAGATTCAGTTCTTCTG
GTTTGTCATTGTTGCCTTCCTGCCTCAGACTTCATGGTTTCTCAGTTATTCTAGAATT
TAATTTCTATGCACCGAAAATGTAACGTAAAATGTTTTATACTATCAGCTAAACTAATCAGAAATCATGATAAATATGACTTTAAGATATTTAATGTGAAAGTCAATAGTACATGAGAAT
CCATGATTAAACTGACACTGGAAAAGTACGTACGCTATTTTCTCGATTATTCTAGCTATCATGAATCATATTAAACTGCTAAGTTACAGTCAGGAGGTCCAATTTGGGAGGTGCAAATGG
GAAGGAAAGATGGCATTACTGCTAGCAAGAATGCAGCAAATAATAACATCCCAGGTCCAAACTCCACTGTTGATGTGCTCGTAGCTAAGTTCGAGAATGTAGGCCTTACACTTAAAGATA
TGGTTGCCCTTTCAG
GTTAATCATCTTTACGCCTTCTTATTCACATGCTATTAGTAGGATTGACAAATCAATCCATTTATCCATCCACAGGAAATTTTTTAATGGATTAATGAATTATTT
TGATCCCATCCATTGGATACGGATTAAGATTTATCCAATTCATCCATTTTGCTGGCCCCTAAGCTATTAGAATTTAGTAATATTTTTCATCATTGAGAAACAAGATCAGCATTTTTTTCC
CATCCCTCTCATTTTTTCAGGTGCGCACACTATAGGGAAAGCTCGGTGCAGAACATTTAGGTCGCGCTTACAGACTAGTAGTAACATTGATTTCGTCGCATCATTGCAACAGTTGTGCTC
AGGACCCGACACAGTTGCACATCTTGACCTGGCTACACCTGCTACGTTTGATAATCAATATTTTGTAAATCTTCTATCTGGGGAGGGATTGCTCCCATCAGACCAGGCTCTTGTGAATGG
CAATGATCAGACACGACAGATTGTCGAAAACTACGTGGAGAACCCATTAGCTTTCTTTGAGGACTTCAAACTTTCTATGTTGAAAATGGGAAGCTTGGCATCACCAACTCAAACTAACGC
CCAGATTCGTAGGAACTGCCGAACTATTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAATTAGTACTATTGTGTCTACTGATACTGAAGCTCACTCCAGCCTTTGCAACCACCCCGAATGATGCCTATGGTGGTGATAGTAGTGGCTGTCCATTAGGGACTGACATATACCAA
TACACTTGCCCTGAAGCTGAGGCCATCATATTCTCTTGGGTGGAGCAGGCAGTGTCTCAAGACTCAAGAATGGCAGCCTCACTTCTTAGGCTACATTTCCATGATTGCTTTGTTAAT
GGT
TGTGATGCTTCAGTCTTGCTAGATGACACACAGGACTTTGTTGGTGAGAAAACTGCGGGTCCAAATTTGAATTCCCTGAGAGGATTCGAAGTAATCGACCAAATCAAATCCGAACTGGAA
CTAGTCTGTCCACAGACTGTCTCTTGTGCTGACATACTCGCAACTGCTGCCAGAGATTCAGTTCTTCTG
TCAGGAGGTCCAATTTGGGAGGTGCAAATGGGAAGGAAAGATGGCATTACT
GCTAGCAAGAATGCAGCAAATAATAACATCCCAGGTCCAAACTCCACTGTTGATGTGCTCGTAGCTAAGTTCGAGAATGTAGGCCTTACACTTAAAGATATGGTTGCCCTTTCAG
GTGCG
CACACTATAGGGAAAGCTCGGTGCAGAACATTTAGGTCGCGCTTACAGACTAGTAGTAACATTGATTTCGTCGCATCATTGCAACAGTTGTGCTCAGGACCCGACACAGTTGCACATCTT
GACCTGGCTACACCTGCTACGTTTGATAATCAATATTTTGTAAATCTTCTATCTGGGGAGGGATTGCTCCCATCAGACCAGGCTCTTGTGAATGGCAATGATCAGACACGACAGATTGTC
GAAAACTACGTGGAGAACCCATTAGCTTTCTTTGAGGACTTCAAACTTTCTATGTTGAAAATGGGAAGCTTGGCATCACCAACTCAAACTAACGCCCAGATTCGTAGGAACTGCCGAACT
ATTAACTAA

Retrieve as FASTA