Entry information : GmPrx[P]95 (Glyma01g32220.1)
Entry ID 9030
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-12-02 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-11-28 (Qiang Li)
Peroxidase information: GmPrx[P]95 (Glyma01g32220.1)
Name (synonym) GmPrx[P]95 (Glyma01g32220.1)
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]95
start..stop
S start..stop
GmPrx134 401 6e-142 5..295 28..320
AhPrx04 330 6e-114 4..294 19..309
MtPrx32 327 2e-112 6..295 42..334
GmPrx188 325 5e-112 1..294 17..309
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 43660275..43660436 162 N° 2 43660728..43660919 192 N° 3 43662258..43662422 165 N° 4 43662536..43662730 195
N° 5 43662777..43662887 111  
join(43660275..43660436,43660728..43660919,43662258..43662422,43662536..43662730 ,43662777..43662887)


exon

Literature and cross-references GmPrx[P]95 (Glyma01g32220.1)
DNA ref. Phytozome 12:   Gm01 (43660275..43662887)
Protein sequence: GmPrx[P]95 (Glyma01g32220.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   295
PWM (Da):   %s   32795.81  
PI (pH):   %s   8.34
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LQLISANKLRSDFYNSQCPQALEAIKAEITSAVRKEPAMGLAFFRLHFIDCFVQGCDASNLLKDTANFTGEQSAIPSLDSRNGTDIIEKVKARVEKLCPGVVSCADILAVAARDSVVALGGPTWRVLLGRTDSTTANLSAVTTNLPSPYMDLDEYISCHIRKIKFNSQRNGCFGVQTIGYIKCLFVLRRIYNESNINPTYARALQAKCPLEGCDDNIVPLDIITPNHFDNAYYKNLLKKKGLLHTDQELYNGGSILCHEPFYATNPLQFRRDFAKAVIKFGNINPLSGTNWQIRK*

Retrieve as FASTA  
Remarks Partial or pseudogene sequence from genomic. Incorrect prediction from Phytozome. (Stop and PS are missing, frame shift).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTCAGCTGATTTCTGCTAATAAGTTACGCTCAGACTTTTATAATTCACAATGTCCCCAGGCACTTGAAGCCATTAAGGCAGAAATAACCTCTGCTGTGAGGAAAGAACCTGCCATGGGT
TTAGCCTTCTTCCGTCTTCATTTCATTGATTGCTTTGTCCAA
GCAAGTTTTGATTTTCCTCAATATTTTATGCCTTATACTACTTATCATACAATTTCGTACAATATGCATTTTCCTCAT
GCATGAGTTCCAATATTCTTCTACGTATGAAAATTAAGATTACTTAACAATTTAAAACCACATAAAATATCATAGTCACACAGACATATTTATAGGATGATGCGGAAGAAAGAGAAAAAA
AAATCCCTTTATTATTTGGTTAACCCGGTTCATAGAAAAATTAAGGTTTTTTTCTTCTTCTGATTTTCTTGCTTGAATATATCTATTATGTAGGGATGTGATGCATCAAACTTGTTGAAA
GACACAGCAAATTTCACGGGCGAACAAAGTGCAATTCCTAGTCTTGATTCTAGAAATGGTACGGATATCATAGAGAAGGTAAAAGCTAGAGTGGAGAAGCTGTGCCCTGGTGTTGTCTCT
TGCGCTGACATTCTAGCTGTTGCTGCGAGAGATTCTGTTGTTGCC
GTGAGTATTGAAATAACTGTTTGGATTGTAGCTGCTGGTTAATGGTTTCAAAATTATGATTTGTGTCAATTTTTT
GGTACATATACCGCTGATCGAAGTCACTCTTTTTCAATAATTCAACGATCATGTATAAGATATTTTGGATAAAATTGAACATTTATAATTGTGTAATCTTATAATTGACACTTATTCATA
TATAAAAAATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATAAAAAAATATATTATGTTAAATTAATTTTATTTAATGAAATA
ATTTTTGTTATTTAATGAAGTATTTAGTTCTAGAATTTCCTGAAAAAATGAGAGTTGATATACTTCATAAGAAATTTTAATTCGATCGAAGATTGAATTAAAAGAATTAGTATATATATA
TATATATTATGGTTTTCCATACATATTATTTATGGATGAAGCTCATTTTATATTCTTCAAAACAACATATAATATCAATTATCAATAAAGATTAGTTTAATATATAATTAATAAGAAATA
AACTTATATCTTAAAAGAATATAAATTTAATTTTTAATTCTATAAATATTTTTATATTTTGAATCTTGAGACATGTCCTAATCTTGATAAACTCTCAATTCATTAAAACTAAAGTTATAA
AAAAACATAATACCAACTATAATCTCAAAGTGTAATAACTCTGCCAAATATTTATTTCTGAAACTTGTACTTTTTATTTTCTTTGCATTCCTTTGCTTACTTGTTTTGTTAGGATTAGTT
TATTTAAACTTATTTGTTAAAATAAATGTTTATTTAATAAAATAATTAATTTTTTTTAATATGTTTGTCTAAACTGTTTCTGCTTAAAAAAAATAATTTTATATTTATTTTTAGGAGCAA
ATTCTACTTGTTTCTTTAAAAAATACTTATATAAAACAAACTTATTTTAATTTTTTTTTAAATTTAAACAAGTCCACCTTATTGTGTTATCTATGATATTTATTATGTTTTCTTTTTATT
CCTCTCCTCTTTTTATTACACGTTACCAGCGTGATTTCTGATGGATGAAAACATGATTCCCAGCTAGGTGGACCAACTTGGAGAGTTCTATTAGGTAGAACAGACTCCACAACTGCAAAT
CTAAGTGCTGTTACAACAAATTTACCCTCTCCCTATATGGATCTTGATGAATATATATCTTGCCACATACGGAAAATTAAATTTAACAGCCAAAGGAACGGTTGCTTT
TTCAGGTAATTA
ATTTCCATAATGCTTCGGATCTATTTTTCTATACATAATAAATGTATATTTATTATCACCTGCCTCTAGTTCTTATATACGAAAATTGAATGTGTTACTTAGGTGTTCAAACTATAGGCT
ACATCAAATGTCTATTCGTCCTAAGAAGGATTTATAACGAAAGCAATATAAATCCCACGTATGCAAGAGCATTGCAAGCAAAGTGTCCCTTGGAAGGTTGTGATGACAACATAGTTCCTT
TAGACATCATAACTCCAAATCATTTTGACAATGCTTATTACAAGAATTTACTGAAG
AAAAAGGGTCTTTTGCACACTGATCAAGAGCTCTATAACGGTGGATCCATTTTATGCCACGAAC
CCTTTACAATTTAGAAGAGATTTCGCTAAGGCAGTGATCAAGTTCGGCAACATTAATCCACTTAGCGGCACCAACTGGCAAATCAGAAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTCAGCTGATTTCTGCTAATAAGTTACGCTCAGACTTTTATAATTCACAATGTCCCCAGGCACTTGAAGCCATTAAGGCAGAAATAACCTCTGCTGTGAGGAAAGAACCTGCCATGGGT
TTAGCCTTCTTCCGTCTTCATTTCATTGATTGCTTTGTCCAA
GGATGTGATGCATCAAACTTGTTGAAAGACACAGCAAATTTCACGGGCGAACAAAGTGCAATTCCTAGTCTTGATTCT
AGAAATGGTACGGATATCATAGAGAAGGTAAAAGCTAGAGTGGAGAAGCTGTGCCCTGGTGTTGTCTCTTGCGCTGACATTCTAGCTGTTGCTGCGAGAGATTCTGTTGTTGCC
CTAGGT
GGACCAACTTGGAGAGTTCTATTAGGTAGAACAGACTCCACAACTGCAAATCTAAGTGCTGTTACAACAAATTTACCCTCTCCCTATATGGATCTTGATGAATATATATCTTGCCACATA
CGGAAAATTAAATTTAACAGCCAAAGGAACGGTTGCTTT
GGTGTTCAAACTATAGGCTACATCAAATGTCTATTCGTCCTAAGAAGGATTTATAACGAAAGCAATATAAATCCCACGTAT
GCAAGAGCATTGCAAGCAAAGTGTCCCTTGGAAGGTTGTGATGACAACATAGTTCCTTTAGACATCATAACTCCAAATCATTTTGACAATGCTTATTACAAGAATTTACTGAAG
CCATTT
TATGCCACGAACCCTTTACAATTTAGAAGAGATTTCGCTAAGGCAGTGATCAAGTTCGGCAACATTAATCCACTTAGCGGCACCAACTGGCAAATCAGAAAATAA

Retrieve as FASTA