Entry information : MeAPx06 (cassava4.1_014642m)
Entry ID 9053
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-11-30 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-06 (Christophe Dunand)
Peroxidase information: MeAPx06 (cassava4.1_014642m)
Name (synonym) MeAPx06 (cassava4.1_014642m)
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MeAPx06
start..stop
S start..stop
HbAPx01 477 7e-174 1..250 1..250
MeAPx03 461 1e-167 1..250 1..250
PtAPx03 456 1e-165 1..250 1..249
PbAPx02 456 1e-165 1..250 1..249
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 584873..584991 119 N° 2 585093..585267 175 N° 3 585360..585425 66 N° 4 585931..585979 49
N° 5 586091..586176 86 N° 6 586294..586373 80 N° 7 586490..586592 103 N° 8 586700..586758 59
N° 9 586948..586960 13  
join(584873..584991,585093..585267,585360..585425,585931..585979,586091..586176, 586294..586373,586490..586592,586700..586758,586948..586960)


exon

Literature and cross-references MeAPx06 (cassava4.1_014642m)
DNA ref. Phytozome 12:   scaffold03750 (584873..586960)
Protein sequence: MeAPx06 (cassava4.1_014642m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250
PWM (Da):   %s   27445.97  
PI (pH):   %s   6.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTKNYPKVSEEYQKAVDKAKKKLRGFIAEKGCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRHAAEQGHAANNGLDIAVRLLEPIKQQFPILAYADFYLAGVVAIEITGGPEVPFHPGREDKPEPPPEGRLPDATKGSDHLRDVFGKTMGLSDQDIVALSGAHTGRCHKERSGFEGPWTSNPLIFDNSYFKELLSGEKEGLLQLPSDKALVVDPVFRKYVEKYADEEAFFADYAEAHVRLSELGFAE

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAGAACTACCCAAAAGTTAGTGAAGAGTACCAGAAGGCCGTCGATAAGGCCAAGAAGAAGCTCAGAGGTTTCATTGCCGAGAAGGGCTGCGCTCCTCTTATGCTCCGTATCGCG
TATGTTGTATCTAGGTTTTTTCATCGTTTTATTGCATTATATGTTTGTGTGCTAGAGATTTGATTGTATATTTGGATTGAAATGGTATGGTGGTGTACAGATGGCACTCAGCTGGAACCT
ATGACGTTAAGACCAAGACTGGAGGCCCATTTGGAACCATGAGACACGCAGCGGAACAGGGCCATGCTGCTAACAATGGGCTTGATATTGCTGTTAGACTCCTTGAGCCCATCAAACAGC
AGTTCCCTATCCTCGCCTATGCCGACTTCTATCAG
GTTTGTGGTACTATAATTCTATGATTTAGGATGGGAGTTTCTTGCTGATTGGTTACTCTTTTGGTTTTCTGATTTGTTGTTACTA
TGTGTAGCTCGCTGGTGTCGTTGCCATTGAGATCACTGGTGGGCCTGAGGTCCCATTCCACCCTGGAAGAGAGGTAGTATTTTAATCTAATGGCTGCCTTTCAATTGTTGATATTTCGAT
TTTTGCTCCTTTGGACCTTTTCCCCATTTTTAAATTGTAATTTATGGTTGAGTGTCGATGTTGAAAATTTGTTTGAATTTAGAACAGTATTGAGGAAGATTACTGAAGTGATTGTTTTTT
TAAAAAAATTCTCATTACTATTCTAAATTCACTCCACTAATTGAAAATCACTGCAGTAATTAAACTAAATTGGGATATTCAATTTGTTGGGGAAAGAAAGGGCTTGATGCTCAGTTTCTC
CCTGAATTTATTGGCATATTCAATTTAGCACATTTTTTTTTTTTATTTTTGTCTAAATTAACTCCGAAGTTTTAATTTAAACTGAATTTAGTCCAAATAATTAAGAAATTGAGTTTCAGC
AAGTTATTTCTCTCTCACTCTTCTCTCCTTTCTGTGAGTATTGGCGACGGATTTTATTTTTCCGCCGGTACTAAACAGTTATTCTCTTATTATTCCAGGACAAGCCTGAGCCACCTCCAG
AAGGTCGTCTGCCTGACGCTACCAAGG
GTTAGCTTCTTGCACAATGATTTGTCTATAATTGAAATCGATAAGCATCTCTATGGTTCATCTTTTTATGTATTTGGTGAAGTTTCTTAAACT
GAGGCGTCTTTTTGGCAGGTTCTGATCACTTGAGGGATGTGTTTGGCAAAACAATGGGTCTCAGTGACCAGGATATTGTTGCTCTCTCTGGTGCCCACACCCTGGTCAGATTTCAAATTT
AAGCTTATTTGCTTGTGGTTAATTGCCAAATTTCTGAAGTGTGATTGTGAATATGCCTTTATACTGATTCCTGCTTGTCTTGTTGGGAATGATGACTGCAGGGAAGGTGCCACAAGGAAC
GCTCTGGTTTCGAAGGTCCCTGGACCAGCAACCCATTAATCTTTGACAACTCCTACTTCAA
GTGAGTTGTCTGTCTCTTTCCAACGCAGACTTGTTCGGCCTTTAGCAACTGGGAAATTG
TGTTGTTTATGATTATTAAGACGGTAATTGACGGTGTGCATTCTTCAAAATTGTTAGGGAGCTCTTGAGTGGAGAGAAGGAAGGCCTTCTACAATTGCCATCTGACAAAGCTCTCGTTGT
TGATCCTGTCTTCCGCAAATATGTTGAAAAATATGCTGCT
GTATGTGTCATTATTTTGTAAACCGAAGTTAAAAGTGCTGATGACATTAAAATAAAACGTTTGATAATTGCTAATTGCTG
GTAGCTGATAGTATTTCCTGAATGCAGGATGAAGAAGCATTCTTTGCTGATTATGCTGAGGCCCATGTGAGGCTCTCTGAGCTGGGGTAAGCTTCAATTCTCAATAATTTGGTTTCTACC
TGCTTCGATAATATTTAATTTTCAAGTGATTGTCCAACGTTTTTGACCTAGAAATTTATAATAATTAATGGCTAGTCAACGTTTTTCTTGGCATTCCTTGCCGTTAATTTTTGGGGCTAG
CTGTCATTGGATTTATCCTCCGCATTGTTTTGCAGATTTGCGGAGGCC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAGAACTACCCAAAAGTTAGTGAAGAGTACCAGAAGGCCGTCGATAAGGCCAAGAAGAAGCTCAGAGGTTTCATTGCCGAGAAGGGCTGCGCTCCTCTTATGCTCCGTATCGCA
TGGCACTCAGCTGGAACCTATGACGTTAAGACCAAGACTGGAGGCCCATTTGGAACCATGAGACACGCAGCGGAACAGGGCCATGCTGCTAACAATGGGCTTGATATTGCTGTTAGACTC
CTTGAGCCCATCAAACAGCAGTTCCCTATCCTCGCCTATGCCGACTTCTATCAG
CTCGCTGGTGTCGTTGCCATTGAGATCACTGGTGGGCCTGAGGTCCCATTCCACCCTGGAAGAGAG
GACAAGCCTGAGCCACCTCCAGAAGGTCGTCTGCCTGACGCTACCAAGGGTTCTGATCACTTGAGGGATGTGTTTGGCAAAACAATGGGTCTCAGTGACCAGGATATTGTTGCTCTCTCT
GGTGCCCACACCCTG
GGAAGGTGCCACAAGGAACGCTCTGGTTTCGAAGGTCCCTGGACCAGCAACCCATTAATCTTTGACAACTCCTACTTCAAGGAGCTCTTGAGTGGAGAGAAGGAA
GGCCTTCTACAATTGCCATCTGACAAAGCTCTCGTTGTTGATCCTGTCTTCCGCAAATATGTTGAAAAATATGCTGCT
GATGAAGAAGCATTCTTTGCTGATTATGCTGAGGCCCATGTG
AGGCTCTCTGAGCTGGG
ATTTGCGGAGGCC

Retrieve as FASTA