Entry information : MeAPx07 (cassava4.1_028424m)
Entry ID 9054
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2012-01-05 (Qiang LI)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang Li)
Peroxidase information: MeAPx07 (cassava4.1_028424m)
Name (synonym) MeAPx07 (cassava4.1_028424m)
Class Ascorbate peroxidase     [Orthogroup: APx002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MeAPx07
start..stop
S start..stop
MeAPx01 486 8e-176 1..241 119..359
HbAPx02 475 2e-171 1..241 103..343
MeAPx05 477 4e-171 1..241 117..357
PtAPx07 461 8e-165 1..241 113..353
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2340..2460 121 N° 2 2157..2257 101 N° 3 1990..2077 88 N° 4 1591..1658 68
N° 5 1424..1510 87 N° 6 498..572 75 N° 7 325..402 78 N° 8 154..258 105
complement(join(154..258,325..402,498..572,1424..1510,1591..1658,1990..2077,2157 ..2257,2340..2460))


exon

Literature and cross-references MeAPx07 (cassava4.1_028424m)
DNA ref. Phytozome 11:   scaffold03004 (2460..154)
Protein sequence: MeAPx07 (cassava4.1_028424m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   241
PWM (Da):   %s   26516.34  
PI (pH):   %s   6.05
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
VRLGWHDAGTYNKNIEEWPKRGGANGSIRFEVELKHGANAGLVNALNLLQPIKDKYSGVTYADLFQLASAIAIEAGGPKIPMKYGRVDVSAPDDCPEEGRLPSAGPPKPADHLREVFYRMGLNDDIVALSGAHTLGRSRPDRSGWGKPETKYTKSGPGEPGGQSWTAEWLKFDNSYFRDIKERKDEDLLVLPTDAVIFEDSSFKVYAEKYAADQKAFFKDYSEAHAKLSNLGAKFDPPQ

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (Both 5' end and 3' end are missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTTCGCCTGGGATGGCATGATGCTGGTACGTATAACAAGAACATAGAGGAGTGGCCAAAGAGAGGTGGAGCTAATGGTAGTATCAGATTTGAAGTTGAGTTGAAACATGGAGCCAATGCA
G
GTAATTTATTTGGAATATTATGCGTAGTTAGGTTAGTTTATAATATAATATTTGTTCCTAATGGACTGGCATTTCAATTCAGGCTTGGTGAATGCTTTGAATCTTCTTCAGCCTATCAA
GGACAAGTACTCTGGTGTGACATATGCAGATTTGTTCCAGTTAGCCAGTGCTATTGCTATAGAG
GTCTTTATTTCTCTCAACATGGAATTAGTATCATCTTTCACTTACTCTCAAAATTG
CATATTCATATTTGTAATTTTAGGAAGCTGGGGGTCCCAAGATTCCCATGAAATATGGAAGGGTTGACGTTTCAGCACCTGATGACTGTCCTGAAGAGGGGAGGCTTCCTAGTGAGTGAA
TTAGCTTTGCTTTTGTTGTATTACTTGTGTAACGAAAAAGTCTTATTCCTCTTTATTACCTCCTTTATAAGATGCACTCTTGTAAAATCCTGCTGCTTGATATATATATATTTCTTTGCA
TACTGTGATTGAAATGCCTGAACTCCAGCAAATATTCAATGTACTATATCAGCATACCTTGTTCTGCCTATCTCATTTTGGAGCTCTAGATTCATAGATCATTTCCAGATTAGTTTGTTT
TTGTTATAAATGTGCATTTGGCTATCTCAGACTTCTGCGTCAAACTAGCGACTGATTTTGGCAATATCAATTTAATGCTTAGGTGCTGGGCCCCCTAAACCTGCGGATCATTTGCGAGAA
GTTTTCTACAGAATGGGTTTAAATGACCAG
GTAACCTTTATTGAACACATACTTTATCATTGATCCTATCTTGTCAGCATCTGGCGCTTGTTGAATTATTTTATCTGCAGGATATAGTTG
CATTATCCGGTGCACACACCCTAGGAAGGTCCAGACCTGACCGCAGTGGTTGGGGAAAACCAGAGACTAAGTATACG
GTATAAAAACCAAAATCAGCTGATTATCTGGAAATAGTAAAAT
TTATTTTTCTGTGATGCTTACATTGGATGAGTGTTGTATCCTATCTTCAACTGAGGATTGGAGATTTTGCAGTCAAATTGTTAGCATGTAATTTATTTCGCTTTATTATCTCCTAATATT
CAAAAGGTTCCTTTAGCTGCTACCAAAGCTAAGTAGCTAACATATCCTCTCTCTATCTTCTCTTTTGCTCTCACATGCACGCTAGCATTCCTCTGCACACTCATTTTGTATCGCTAAAAC
CCTAGAGTTCCTTCTTTTTGCCGTTGTATAATTAATTGTTGCTCAATTAGTATGCTTTTGGCTGATTGATAGCAATAACACAGCCAAAAAGTTGAATAGCATAACCTCATAAGGTTTAGG
TGGTTAAAGCTTGGCTGGTAGATTTCTTCCTTGCCTTTGAAAAGTTGAAGAAGTGAATGGTGTATGTTAAACTGTACAGCCTTATTCTAAATGCATAACTGCTGGTAGCTTTCTTAGGAG
AAAAGTGAAATGCAGTTTGACATGCTAAATTTACCAGTTCAATTACTTCTTGTATATACATATGCAGACACACACACACACTCGTCATTAGTGCCCTCTATATTCAATTGTTTAGATATA
TGATCTGTAGCGTCTCTATCAGTTGCCCTTTATGTGCATGTGCAATTAAACGTCCATACTCTGGTTTGTTTTTGTCATACTTATCAAAGCCCTTTTGTTTCTTTCATGGAATGTGTCAAA
TGTAGCGTGACAAATGAATGAACTAGTAATAATTTCCAACACTAGAAACAAGGAGTTAGATTTTCACATTTTGCATTGTGCATGACAGAAAAGTGGACCAGGAGAACCAGGAGGACAATC
CTGGACCGCAGAATGGCTCAAGTTTGACAACTCTTACTTCAGG
GTTTGAATTCAGAATCAGAACTCACATTATATATTGTAAGGAGAAATGGAGGGGTAATAAAATTCTAGCTTGCTGAA
TGAGATTTCTCCATACAGGATATCAAAGAAAGAAAGGATGAAGATCTACTTGTATTACCAACTGATGCTGTTATCTTCGAAGATTCTTCTTTCAAGGTCAATAATTATGCTTCAAAGTCG
CAAAGAACAATCTCAGTATCTAAGCAATTGAAAACTTTGCAGGTATATGCTGAGAAATATGCTGCAGACCAGAAAGCATTTTTCAAGGATTATTCTGAAGCCCATGCGAAGCTCAGCAAT
CTTGGAGCTAAATTTGATCCTCCCCAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTTCGCCTGGGATGGCATGATGCTGGTACGTATAACAAGAACATAGAGGAGTGGCCAAAGAGAGGTGGAGCTAATGGTAGTATCAGATTTGAAGTTGAGTTGAAACATGGAGCCAATGCA
G
GCTTGGTGAATGCTTTGAATCTTCTTCAGCCTATCAAGGACAAGTACTCTGGTGTGACATATGCAGATTTGTTCCAGTTAGCCAGTGCTATTGCTATAGAGGAAGCTGGGGGTCCCAAG
ATTCCCATGAAATATGGAAGGGTTGACGTTTCAGCACCTGATGACTGTCCTGAAGAGGGGAGGCTTCCTA
GTGCTGGGCCCCCTAAACCTGCGGATCATTTGCGAGAAGTTTTCTACAGA
ATGGGTTTAAATGACCAG
GATATAGTTGCATTATCCGGTGCACACACCCTAGGAAGGTCCAGACCTGACCGCAGTGGTTGGGGAAAACCAGAGACTAAGTATACGAAAAGTGGACCAGGA
GAACCAGGAGGACAATCCTGGACCGCAGAATGGCTCAAGTTTGACAACTCTTACTTCAGG
GATATCAAAGAAAGAAAGGATGAAGATCTACTTGTATTACCAACTGATGCTGTTATCTTC
GAAGATTCTTCTTTCAAG
GTATATGCTGAGAAATATGCTGCAGACCAGAAAGCATTTTTCAAGGATTATTCTGAAGCCCATGCGAAGCTCAGCAATCTTGGAGCTAAATTTGATCCTCCC
CAG

Retrieve as FASTA