Entry information : MeAPx09 (cassava4.1_013404m)
Entry ID 9056
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-11-30 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-06 (Christophe Dunand)
Peroxidase information: MeAPx09 (cassava4.1_013404m)
Name (synonym) MeAPx09 (cassava4.1_013404m)
Class Ascorbate peroxidase    [Orthogroup: APx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MeAPx09
start..stop
S start..stop
LeAPx06 448 3e-161 1..282 1..288
LsaAPx02 442 8e-159 1..282 1..285
PtAPx05 441 3e-158 1..281 1..287
CiAPx02 438 2e-157 1..279 1..282
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2248553..2248665 113 N° 2 2248742..2248866 125 N° 3 2248969..2249018 50 N° 4 2249269..2249334 66
N° 5 2249401..2249449 49 N° 6 2249538..2249620 83 N° 7 2249694..2249773 80 N° 8 2249868..2249967 100
N° 9 2250059..2250238 180  
join(2248553..2248665,2248742..2248866,2248969..2249018,2249269..2249334,2249401 ..2249449,2249538..2249620,2249694..2249773,2249868..2249967,2250059..2250238)


exon

Literature and cross-references MeAPx09 (cassava4.1_013404m)
DNA ref. Phytozome 12:   scaffold07520 (2248553..2250238)
Protein sequence: MeAPx09 (cassava4.1_013404m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   282
PWM (Da):   %s   31337.1 Transmb domain:   %s   o253-275i
PI (pH):   %s   7.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAPIVDSEYLKEIEQARRDLRALMSSKNCAPLMLRLAWHDAGTYDAKTKTGGPNGSIRNEKEYKHEANNGLKIAIDLEEIKAKHPKLTYADLYLAGVVAVEITGGPTIDFVSGRKDSTESPEEGRLPDAKKGATHLRDVFYRMGLSDMEIVALSGGHTGKAHRDRSGFEGAWTKEPLKFDNSYFKELLNENSEVLKLPTDKALVEDPKFRSYVERYADEDAFFTDYAAAHKKLSELGFTPAFKAAKFTLRAQSAVGVAIVAAMVILSYYYEVHKRLK

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCACCAATAGTGGATTCAGAGTACTTGAAGGAGATAGAGCAGGCTCGTCGGGACCTTCGTGCTCTTATGTCCAGCAAAAACTGCGCCCCTCTCATGCTTCGCTTAGCGTAAATA
CCGTATTATCCTCTGTTTCTTATGCAGTTGCCAAGTTCTGAAAATTGATAACGGAAATTTTTTGTGCAGGTGGCATGACGCGGGAACTTACGATGCGAAAACGAAGACTGGAGGACCTAA
TGGTTCCATCAGGAACGAGAAAGAGTACAAACATGAAGCTAATAATGGTCTTAAAATTGCTATTGATTTGATGG
GTGACCTCTCCTTTCCTCGTTTCTTTTATGGATTTTTTTTAAGGTT
GTTTTTTTTTAAGTTTTCCCCCCTTTAAAATAGCTTCTGGGCTCTGTTTGTTTCAGAGGAAATCAAGGCCAAACACCCCAAACTTACGTATGCGGACCTCTATCAGGTGATTATACTTAC
TTTGGGTTCATCTGATATAATTACGTTCAATAACACTAGATTTTTTATTCTAGATATATTATCTCAAGGAGAAAATCAGATTCAAGTTTCTGATTTTCTCCTCTTATTATATCTAGACCA
GTAATATGAAGGGAAAAACTTGGTTTTGGGCAATATATATGACCAGTATCATGAAAGTTATCTCCTGTTGTAGATATAAATTTAACTTTTTTAATCTTTTTCTTTGTAAATTTTAGCTTG
CTGGGGTTGTTGCAGTTGAGATCACTGGAGGACCAACTATCGACTTTGTTTCAGGAAGAAAG
GTATTCTTATCATAGAACTCTGTACCACCTAATAGTTCTGGTTTAGTAACTCTGTTTC
TTTAACAGGATTCAACTGAATCTCCTGAAGAAGGTCGTCTTCCTGATGCAAAAAAGGGTTTGTCTCTGACTATAGTTATGGAGAGGAGATGAATTTCATTATGCCACTTTATCCAAGATA
CTGTTCTAGTTTAATATGGTTTCAGGTGCAACGCATTTAAGAGATGTCTTTTATCGAATGGGTCTATCAGACATGGAAATTGTGGCACTCTCTGGCGGTCACACATTGGTAATTTTCTCA
GAAATAGGAGTTCAATTGTTTTAAACAAGCTTGCACTTGATGTTTTTGCCTGCTTTCACAGGGAAAGGCACATAGAGATAGATCAGGCTTCGAAGGTGCTTGGACAAAGGAGCCTTTGAA
GTTTGACAACTCCTACTTCAA
GTAAGAAATGTATATCATGTATAGTTGCATGACTTTATATATTGCATCAATATGTGGAAACTGACTGTTCATGTGCTGTCAACTCTCTAATCAGGGAGC
TTTTGAATGAAAATTCCGAGGTATTAAAACTCCCCACGGATAAGGCTCTGGTGGAAGATCCCAAGTTCCGCTCTTATGTTGAGCGATATGCAAAG
GTAATTAATCAGACTAAATAAAGCT
TTCTGCTTCAGTGATAACTAGTAGGTGTGAAATGAACTTGTGATTTGCATAATTACTTTGTGGCAGGATGAGGATGCATTCTTTACAGACTATGCCGCAGCGCACAAGAAACTGTCGGAG
CTGGGCTTTACTCCGGCTTTCAAAGCTGCAAAGTTTACACTTCGTGCACAGAGTGCTGTGGGAGTTGCTATAGTTGCAGCTATGGTAATATTAAGTTACTATTACGAGGTTCACAAAAGA
CTCAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCACCAATAGTGGATTCAGAGTACTTGAAGGAGATAGAGCAGGCTCGTCGGGACCTTCGTGCTCTTATGTCCAGCAAAAACTGCGCCCCTCTCATGCTTCGCTTAGCGTGGCAT
GACGCGGGAACTTACGATGCGAAAACGAAGACTGGAGGACCTAATGGTTCCATCAGGAACGAGAAAGAGTACAAACATGAAGCTAATAATGGTCTTAAAATTGCTATTGATTTGATGG
AG
GAAATCAAGGCCAAACACCCCAAACTTACGTATGCGGACCTCTATCAG
CTTGCTGGGGTTGTTGCAGTTGAGATCACTGGAGGACCAACTATCGACTTTGTTTCAGGAAGAAAGGATTCA
ACTGAATCTCCTGAAGAAGGTCGTCTTCCTGATGCAAAAAAGG
GTGCAACGCATTTAAGAGATGTCTTTTATCGAATGGGTCTATCAGACATGGAAATTGTGGCACTCTCTGGCGGTCAC
ACATTG
GGAAAGGCACATAGAGATAGATCAGGCTTCGAAGGTGCTTGGACAAAGGAGCCTTTGAAGTTTGACAACTCCTACTTCAAGGAGCTTTTGAATGAAAATTCCGAGGTATTAAAA
CTCCCCACGGATAAGGCTCTGGTGGAAGATCCCAAGTTCCGCTCTTATGTTGAGCGATATGCAAAG
GATGAGGATGCATTCTTTACAGACTATGCCGCAGCGCACAAGAAACTGTCGGAG
CTGGGCTTTACTCCGGCTTTCAAAGCTGCAAAGTTTACACTTCGTGCACAGAGTGCTGTGGGAGTTGCTATAGTTGCAGCTATGGTAATATTAAGTTACTATTACGAGGTTCACAAAAGA
CTCAAG

Retrieve as FASTA