Entry information : MeAPx10 (cassava4.1_024509m)
Entry ID 9057
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2012-01-05 (Qiang LI)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: MeAPx10 (cassava4.1_024509m)
Name (synonym) MeAPx10 (cassava4.1_024509m)
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MeAPx10
start..stop
S start..stop
PtriAPx02 452 6e-164 1..244 1..244
CclAPx05 452 7e-164 1..244 1..244
QshAPx01 451 2e-163 1..244 1..244
CroAPx02 449 5e-163 1..244 1..244
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 52422..52540 119 N° 2 52622..52796 175 N° 3 52907..52972 66 N° 4 53064..53112 49
N° 5 53194..53276 83 N° 6 53367..53446 80 N° 7 53702..53804 103 N° 8 53886..53942 57
join(52422..52540,52622..52796,52907..52972,53064..53112,53194..53276,53367..534 46,53702..53804,53886..53942)


exon

Literature and cross-references MeAPx10 (cassava4.1_024509m)
DNA ref. Phytozome 12:   scaffold05133 (52422..53942)
Protein sequence: MeAPx10 (cassava4.1_024509m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   244
PWM (Da):   %s   27018.85  
PI (pH):   %s   6.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGKWYPKVSDEYQKAVQKCKRKLRGHVAEKRCAPIVLRLTWHSAGTFDVKTRTGGPFGTIRHPEELAHQANNGLDIAVRLLEPIKEQFPILTYADFYLAGVVAVEITGGPEIPFNPGRPDKSNPPPEGRLPDATKGADHLREVFGRMGLSDKDIVALSGGHTGSCHKERSGFEGPWTTHPLIFDNSYFKELLSGEKEGLIQLPSDKALLQDPVFRALVEKYADEDAFFEDYAEAHLKLSEL

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCAAGTGGTACCCCAAGGTGAGCGACGAATATCAGAAAGCAGTCCAGAAATGCAAAAGAAAGCTTAGAGGACACGTCGCTGAGAAGCGCTGCGCTCCCATCGTCCTTCGCCTAACG
TAAGATCTCTACCATTCTGCGTGCGTGTGTGTGTAAATTTGTGGGGAAGCATTAAGAGAATGGTCTGGTGTTGTACGTAGATGGCACTCTGCTGGTACTTTTGATGTGAAGACGAGAACA
GGGGGACCTTTTGGGACGATCAGGCACCCAGAGGAGCTTGCACACCAGGCCAATAATGGTCTTGATATTGCTGTGAGACTTCTGGAGCCCATCAAGGAACAGTTTCCTATCTTGACCTAT
GCTGACTTCTACCAG
GTATGTCTTTGTTGATGTTGGACATCGTGAATTGGCCAGCCATTTTCTTATGTAAGTAGCTTAGCAGCTTCTCTCTGGGATTGAAACTGACGTGTGTTTCATTGT
TACAGTTAGCTGGAGTTGTTGCTGTAGAAATTACAGGAGGGCCTGAGATTCCTTTCAACCCTGGGAGACCAGTTAGTGATCAATACTTGTTAACTATGTTAGACATTTACATGGAAAATA
GATTTTATATAGAAATAGTACTAAAATCAAGTGTATGTTCAGGATAAATCTAATCCACCCCCAGAAGGTCGCTTGCCTGATGCTACTAAAGGTGGGTCTTTTATTGTTTAAAGCACAATG
AGAAATATATATCAGAGAAATTACTAATGAATTGTTTTGTGTGTGGTTATAGGTGCTGATCATCTGAGGGAGGTCTTTGGTCGAATGGGTCTCAGTGACAAAGACATTGTTGCCTTGTCT
GGTGGTCACACCCTG
GTATTTTTATTTGCTCAGCAAGGAATAGGATCAATTAAATAGTGGCATACCATATTATTATGTATTGATTTGGGTTGTTGGATCTTGCAGGGTAGCTGCCACAAG
GAGCGTTCTGGATTTGAGGGTCCCTGGACCACTCATCCTCTCATTTTTGACAACTCTTATTTCAA
GTAAGCTATTCTCTAATTTGTTTCAAGTATAACTGTATATGTGGAAGCCCGGCCG
CTATCCCATTCAAATCTCAGTTGAAGTCGATTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNGTGGAGTCTATTCCAAATCAGAAAGCAATGGATTGGCCCTGTTCAGCAGAAATAACTTT
TCAACACTAATGTTTTGACTCAAACTATTTTTAAAATTGTTGCCGAACCAAAACCTTTGATGTTTGATTTCTCTAAACAGGGAATTGTTAAGTGGAGAGAAGGAAGGCCTTATCCAGCTG
CCATCTGATAAGGCTCTTTTACAGGATCCAGTCTTTCGAGCTCTAGTTGAAAAATATGCTGCA
GTGAGTATGGTTATTGTTTTTGTGAATTTGGTAACAAAATGTAACTACTAAACCATT
TACCTGTGGTGGGTTTTGCTTTAGGATGAGGATGCATTCTTTGAAGATTATGCGGAAGCTCATTTGAAGCTCTCAGAGCTT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCAAGTGGTACCCCAAGGTGAGCGACGAATATCAGAAAGCAGTCCAGAAATGCAAAAGAAAGCTTAGAGGACACGTCGCTGAGAAGCGCTGCGCTCCCATCGTCCTTCGCCTAACA
TGGCACTCTGCTGGTACTTTTGATGTGAAGACGAGAACAGGGGGACCTTTTGGGACGATCAGGCACCCAGAGGAGCTTGCACACCAGGCCAATAATGGTCTTGATATTGCTGTGAGACTT
CTGGAGCCCATCAAGGAACAGTTTCCTATCTTGACCTATGCTGACTTCTACCAG
TTAGCTGGAGTTGTTGCTGTAGAAATTACAGGAGGGCCTGAGATTCCTTTCAACCCTGGGAGACCA
GATAAATCTAATCCACCCCCAGAAGGTCGCTTGCCTGATGCTACTAAAGGTGCTGATCATCTGAGGGAGGTCTTTGGTCGAATGGGTCTCAGTGACAAAGACATTGTTGCCTTGTCTGGT
GGTCACACCCTG
GGTAGCTGCCACAAGGAGCGTTCTGGATTTGAGGGTCCCTGGACCACTCATCCTCTCATTTTTGACAACTCTTATTTCAAGGAATTGTTAAGTGGAGAGAAGGAAGGC
CTTATCCAGCTGCCATCTGATAAGGCTCTTTTACAGGATCCAGTCTTTCGAGCTCTAGTTGAAAAATATGCTGCA
GATGAGGATGCATTCTTTGAAGATTATGCGGAAGCTCATTTGAAG
CTCTCAGAGCTT

Retrieve as FASTA