Entry information : SbPrx144 (Sobic.008G010400.1 [2.1])
Entry ID 906
Creation 2008-10-15 (Christophe Dunand)
Last sequence changes 2008-10-15 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-08-04 (Christophe Dunand)
Peroxidase information: SbPrx144 (Sobic.008G010400.1 [2.1])
Name (synonym) SbPrx144 (Sobic.008G010400.1 [2.1])
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Seedlings
Inducer Dark growth
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx144
start..stop
S start..stop
SiPrx54 574 0 20..320 21..321
SiPrx112 570 0 21..320 22..321
SbPrx84 568 0 19..320 27..328
SbPrx83 566 0 20..320 31..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2395..2799 405 N° 2 2167..2332 166 N° 3 532..923 392  
complement(join(532..923,2167..2332,2395..2799))


exon

Literature and cross-references SbPrx144 (Sobic.008G010400.1 [2.1])
Literature Cordonnier-Pratt,M.-M. et al., unpublished.
DNA ref. Phytozome 11:   super_246 (2799..532)
EST ref. GenBank:   AW677275 [3' end]
Protein sequence: SbPrx144 (Sobic.008G010400.1 [2.1])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (296)
PWM (Da):   %s   33629.51 (31112.2)  
PI (pH):   %s   5.05 (5.05) Peptide Signal:   %s   cut: 25 range:25-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAQSIALWLLTTTMALQAGTSWAQLSTGFYSSSCPGLYSAVKPVVQSAIDSEKRVGASIVRLFFHDCFVQGCDASLLLDDTATFQGEKMATPNNGSVRGFEVIDAAKSAVENVCPGVVSCADILAIAARDSVVILGGPSWDVKVGRRDSTTASFSGANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTNFRDHIYNDTNVDGAFARTRQSGCPSTSGTGDNNLAPLDLQTPTVFENDYYKNLVSNMGLLHSDQELFNGGATDALVQSYVSSQSAFFADFVTGMIKMGDITPLTGSAGEIRKNCRRIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, introns 2 and 3) and 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTCAGAGCATAGCTCTCTGGCTCCTGACGACGACGATGGCCCTGCAGGCCGGCACCTCGTGGGCGCAGCTGTCGACGGGCTTCTACTCCAGCTCCTGCCCGGGCCTGTACAGC
GCGGTGAAGCCGGTGGTGCAGTCTGCCATCGACAGCGAGAAGCGCGTGGGCGCCTCCATCGTGCGCCTCTTCTTCCACGACTGCTTCGTCCAGGGATGCGACGCCTCGCTGCTGCTGGAC
GACACGGCCACCTTCCAGGGCGAGAAGATGGCCACCCCCAACAACGGCTCCGTCAGAGGCTTCGAGGTCATCGACGCCGCCAAGTCCGCCGTCGAGAATGTCTGCCCCGGCGTCGTCTCC
TGCGCCGACATCCTCGCCATCGCCGCCAGGGACAGCGTCGTCATC
GTAAGCCCCCATCGACTTCATTCCAGATGAGAATGCATGAACCTGCAACTGTGGATATGCAGCTGGGTGGTCCGA
GCTGGGACGTCAAGGTCGGCAGAAGGGACTCGACGACGGCGAGCTTCAGCGGCGCCAACAACAACATCCCGCCGCCGACGTCGGGGCTCGCCAACCTCACATCGCTCTTCGCCGCGCAGG
GCCTCTCGCAGAAGGACATGGTCGCGCTCTCTG
GTACGTACGACATGCTACCTATAGGCTACAAATTTCCAACTTGTTCGTAATTAAACTAACTGAGATTGCAACAGCAACAGCATACAA
AAAACATGCATGTCCGGCAAATTTCTTATACATCCATGGGACGCTTTTCGAAGATCAAGGAAAAGAAAGACACTGCTTGATGACTGTTATACCAATATTGCTTGCTACTTAGACGACATT
ATGTTTTATTTCAACTATGGATGACATCTTTTAGAAAAGATCAACTGTAGTGGAATGAGAGAATGATAAAAAAAAAACACTATACATACTTGTCAAATAAAGCTAATAAGCTAGCTTTAG
TGGTTATATAAATACAATACAGCTGGAGGACACTACGATCGACCACAATATTCACACCAACGAAATTGATAGCTCAGTTTTGACTTCAAAGCTGGATTTACAACTTTCTCGATCTCTTCT
TCACATGCATATATACATATAGTTATATACTACTCGATCTCTTTCGCTTGCAGCTGATTGGTGAATATTCACCTAACATCAGATGTCGGTTAATGGCATAGCATACATGCATAGCACGAG
AGTTGGTACAGACAGATAATAAGGATGGAACGAATCAATGAAATGACATAAAGTTTGCAAAGGTGACAACGAGATGCCGGTATATATATATGGCTTTAATTAATTTCTAGAAGGAAGGAA
AATCTTTGTGTGCTACAGAAAAGCTTCATGCTTTTGCATGTTATTAATTATAAACCTGGCGACAATATGGCAACTTCCACGAATTGTATGCGTCTGGTTGAAACATCATTTCTGCCCCAT
CATGTATCTTCATTCGATGCTGATTTTGTACTAAATGAAGCCTAAATAAATTAAAGTTGTTTAGTCGATATTCCCTAGCTAGATTACAATGAACTGGAACCACAAATTAAATAATGGTCA
TTTTGTGTGTCGCTTCACAAATAGAGAATCAATACTTCTTTCTGTAGCATTTCTTTCTTGAGACCTCTTTTTTTCTTATATATTTACAAAAACTACGAACCACATGCATGTTTTGATTTT
TTTTTTGTTAAGTAGAGCTAACGTACTAGCGTAGGTGACCAATCTTCTTGCAAAAAAAATAAAAAAAAATTAAAAAGGTTCAGTGTACGTGTTCGCGCCCACTCATTTCCCCTAAGACAT
TAATTGAAATATTTGAATAATATAGTATAATTTATGTCCTCCTTATGTTGTTTGCTTCTTAATTTTGCTACTATAGGTGCTCACACCATAGGCCAAGCACGCTGCACCAACTTCAGAGAC
CACATCTACAACGACACCAACGTCGACGGAGCCTTTGCAAGGACAAGGCAATCAGGTTGTCCTAGCACCTCAGGAACAGGTGACAACAACTTGGCACCATTGGACCTTCAAACACCAACC
GTCTTTGAGAACGACTACTACAAGAACCTTGTTAGCAACATGGGGCTCCTACACTCTGACCAAGAGCTCTTCAACGGTGGCGCCACCGACGCGCTAGTGCAATCATATGTTAGTAGCCAA
AGCGCGTTTTTTGCAGATTTTGTGACTGGCATGATCAAGATGGGTGACATTACACCGTTGACGGGCTCCGCTGGGGAGATCAGGAAGAACTGCAGAAGGATTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTCAGAGCATAGCTCTCTGGCTCCTGACGACGACGATGGCCCTGCAGGCCGGCACCTCGTGGGCGCAGCTGTCGACGGGCTTCTACTCCAGCTCCTGCCCGGGCCTGTACAGC
GCGGTGAAGCCGGTGGTGCAGTCTGCCATCGACAGCGAGAAGCGCGTGGGCGCCTCCATCGTGCGCCTCTTCTTCCACGACTGCTTCGTCCAGGGATGCGACGCCTCGCTGCTGCTGGAC
GACACGGCCACCTTCCAGGGCGAGAAGATGGCCACCCCCAACAACGGCTCCGTCAGAGGCTTCGAGGTCATCGACGCCGCCAAGTCCGCCGTCGAGAATGTCTGCCCCGGCGTCGTCTCC
TGCGCCGACATCCTCGCCATCGCCGCCAGGGACAGCGTCGTCATC
CTGGGTGGTCCGAGCTGGGACGTCAAGGTCGGCAGAAGGGACTCGACGACGGCGAGCTTCAGCGGCGCCAACAAC
AACATCCCGCCGCCGACGTCGGGGCTCGCCAACCTCACATCGCTCTTCGCCGCGCAGGGCCTCTCGCAGAAGGACATGGTCGCGCTCTCTG
GTGCTCACACCATAGGCCAAGCACGCTGC
ACCAACTTCAGAGACCACATCTACAACGACACCAACGTCGACGGAGCCTTTGCAAGGACAAGGCAATCAGGTTGTCCTAGCACCTCAGGAACAGGTGACAACAACTTGGCACCATTGGAC
CTTCAAACACCAACCGTCTTTGAGAACGACTACTACAAGAACCTTGTTAGCAACATGGGGCTCCTACACTCTGACCAAGAGCTCTTCAACGGTGGCGCCACCGACGCGCTAGTGCAATCA
TATGTTAGTAGCCAAAGCGCGTTTTTTGCAGATTTTGTGACTGGCATGATCAAGATGGGTGACATTACACCGTTGACGGGCTCCGCTGGGGAGATCAGGAAGAACTGCAGAAGGATTAAT
TAA

Retrieve as FASTA