Entry information : MeAPx[P]04 (cassava4.1_031401m)
Entry ID 9060
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2012-01-05 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-12-01 (Qiang Li)
Peroxidase information: MeAPx[P]04 (cassava4.1_031401m)
Name (synonym) MeAPx[P]04 (cassava4.1_031401m)
Class Ascorbate peroxidase     [Orthogroup: APx003]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MeAPx[P]04
start..stop
S start..stop
MeAPx09 289 9e-100 1..214 39..275
HaAPx06 265 4e-90 1..214 41..282
HaAPx03 263 2e-89 1..214 39..278
PtAPx05 263 2e-89 1..214 39..281
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 994019..994142 124 N° 2 994233..994288 56 N° 3 994420..994479 60 N° 4 994548..994600 53
N° 5 994682..994763 82 N° 6 994835..994991 157 N° 7 995164..995273 110  
join(994019..994142,994233..994288,994420..994479,994548..994600,994682..994763, 994835..994991,995164..995273)


exon

Literature and cross-references MeAPx[P]04 (cassava4.1_031401m)
DNA ref. Phytozome 11:   scaffold06512 (994019..995273)
Protein sequence: MeAPx[P]04 (cassava4.1_031401m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   214
PWM (Da):   %s   23089.72 Transmb domain:   %s   o191-213i
PI (pH):   %s   8.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
WHDAGTYDAKTKTGGPNGSIRNEKEYNHEANRGLKLAIDLCEEIKAKHPKITYADLYQVGCCSGEVTGGPNIDFVPGRKDSTESAEEGRLPDAKKGLCIAFKGCIFSNGLSDKEIVAHSGGHTGKAHRERSGFEGAWTKEPLKFDNSHFRSETYYPKLLKRDSEGLLKLPLGQDSEKLGFTPPSRAAKGTLLAQSAVGVAVAATVVIFSYY

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (5' end, 3' end and PS in frame are missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCATGATGCGGGAACTTACGATGCTAAAACCAAGACTGGAGGGCCTAATGGTTCCATCAGGAACGAGAAAGAGTACAATCACGAAGCTAATAGAGGTCTTAAACTCGCTATCGATTTG
TGCG
GTGAGCTCTTTTTACTAGTTATATCTGGACGTTTGTTTTGAGATTAGTTTTTCCCCCTTCTTGAAATTGCTTCTGGATTCTGTTTTTCAGAGGAAATCAAGGCCAAACACCCCAAA
ATTACGTATGCTGACCTCTATCAGGTGATT
ACTTATTTTCAGATCATATGATCTAGTTTTGTTCAATAACAATGGAAGGAATTATTTCTCATACTGTTGCAGAAATTATAGATTTAATTT
AACTTGTTTTTTTTTTCTTCTCGGGAAATTTAGCTAGCTGGGGTTGTTGCAGTGGAGAGGTCACTGGAGGTCCAAATATTGACTTCGTCCCAGGCAGAAAGGTATTCTTATGATAGAATG
GCCGTCACCCAATAGTTCTTATCTACTAACTTCTTTGTTTCTTTGTCAGGATTCAACTGAATCTGCTGAGGAGGGTCGTCTTCCTGATGCCAAAAAGGGTCTGTATCTGAGTATCTGCTG
AAGAAAACACTATTGTGTTCATTTCATTGAAACACATACCATTATAATCTAATGTGGTTGCAGGTGCATCGCATTTAAGGGATGTATTTTCTCGAATGGTCTGTCAGACAAGGAAATTGT
GGCACACTCTGGTGGTCATACCCTG
GTAATGTTTTCAGAGATTGGAAATGATTGTTTTTAACGTGCTTGACCTTGATTTTTTGCTTCGTGTCATAGGGAAAGGCACATAGGGAAAGATCA
GGTTTTGAAGGTGCTTGGACAAAGGAGCCGCTGAAGTTTGACAACTCCCACTTCAGGTCAGAAACTTATTATCCTAAGCTTCTGAAACGAGACTCAGAGGGGCTGTTAAAGCTCCCTCTT
GGACAAGACTCTG
GTGGAAGATCCTAAGTTTCGCCCCTATGTTGAGCGATGTGCAGAGGTATTAGGCAGACTATATTCGTTTCCTCGCGTGGATAATTGATACACTGTGTGTGATCTGCA
TAATTACTGTGGCAGGACGAGGATGCATTCTTCACAGACTATGCGGAAGCGCACAAGAAATTATCAGAAGCTGGGCTTTACTCCACCTTCCAGAGCTGCTAAGGGTACACTTCTTGCACA
GAGTGCTGTTGGAGTTGCAGTAGCTGCAACTGTAGTAATATTTAGTTACTATTAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCATGATGCGGGAACTTACGATGCTAAAACCAAGACTGGAGGGCCTAATGGTTCCATCAGGAACGAGAAAGAGTACAATCACGAAGCTAATAGAGGTCTTAAACTCGCTATCGATTTG
TGCG
AGGAAATCAAGGCCAAACACCCCAAAATTACGTATGCTGACCTCTATCAGGTGATTGGTTGTTGCAGTGGAGAGGTCACTGGAGGTCCAAATATTGACTTCGTCCCAGGCAGAAAG
GATTCAACTGAATCTGCTGAGGAGGGTCGTCTTCCTGATGCCAAAAAGGGTCTGTGCATCGCATTTAAGGGATGTATTTTCTCGAATGGTCTGTCAGACAAGGAAATTGTGGCACACTCT
GGTGGTCATACCCTG
GGAAAGGCACATAGGGAAAGATCAGGTTTTGAAGGTGCTTGGACAAAGGAGCCGCTGAAGTTTGACAACTCCCACTTCAGGTCAGAAACTTATTATCCTAAGCTT
CTGAAACGAGACTCAGAGGGGCTGTTAAAGCTCCCTCTTGGACAAGACTCTG
AGAAGCTGGGCTTTACTCCACCTTCCAGAGCTGCTAAGGGTACACTTCTTGCACAGAGTGCTGTTGGA
GTTGCAGTAGCTGCAACTGTAGTAATATTTAGTTACTATTAT

Retrieve as FASTA