Entry information : MePrx102 (cassava4.1_028102m)
Entry ID 9063
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-12-31 (Achraf Jemmat)
Peroxidase information: MePrx102 (cassava4.1_028102m)
Name (synonym) MePrx102 (cassava4.1_028102m)
Class Class III peroxidase    [Orthogroup: Prx020]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx102
start..stop
S start..stop
RcPrx60 492 2e-177 18..319 18..315
PtPrx38 458 1e-163 3..316 1..307
CpapPrx12 451 2e-159 13..316 1..308
PpePrx32 445 5e-159 20..316 21..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 54058..54255 198 N° 2 53194..53952 759  
complement(join(53194..53952,54058..54255))


exon

Literature and cross-references MePrx102 (cassava4.1_028102m)
DNA ref. Phytozome 11:   scaffold02431 (54255..53194)
Protein sequence: MePrx102 (cassava4.1_028102m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (300)
PWM (Da):   %s   34344.22 (32234.1)  
PI (pH):   %s   5.6 (5.89) Peptide Signal:   %s   cut: 20 range:20-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGMEASFIFFLLVLPLVMADLRVGFYQSTCPQAESIVSQVVKYRFNTDPSLPAALLRMHFHDCFVTGCDASILIDSTKQKESEKDAQPNHTVRGYELIDAIKEAVEAACPSMVSCADIITLATRDAVALAGGPNYTVPTGRRDGLVSNIEHVKLPGPTFTVSEAFQVFKAKGLNFADMVTLLGAHTVGVAHCSFFEDRVSNFQGTGSPDPTMDSNLAANLSKICGASNTDPAVFLDQSTGFVFDNEYYKHLLLKRGILQIDQELAIDRTSIGIVSSFATNGIGFKQSFANAMVKLGSTQVIVGNAGEVRTNCRVFNVQK

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAATGGAAGCTTCGTTTATATTCTTTCTTTTGGTCCTTCCCCTTGTAATGGCTGATCTAAGAGTTGGCTTTTATCAATCAACGTGTCCTCAAGCAGAATCGATAGTAAGTCAAGTG
GTGAAATATCGATTTAATACTGATCCATCCCTACCTGCAGCCTTGCTTCGCATGCATTTTCATGATTGCTTCGTTACA
GTACTAAGATTTTCATCTCTAAACACTCAACATATTAATTGT
GCTTTGAATACTTTGGTTTAGTTTGATCATTTAAGTTCTTTTCCACCACTTGTGTCATTACAGGGTTGTGATGCGTCGATTCTTATAGACTCAACCAAGCAGAAAGAATCCGAGAAAGAT
GCACAACCGAACCACACAGTTCGAGGGTACGAGCTAATCGACGCGATCAAGGAAGCCGTAGAGGCTGCCTGCCCTTCGATGGTCTCCTGTGCAGACATCATAACACTTGCAACTAGAGAT
GCTGTGGCTCTCGCAGGAGGCCCCAACTACACTGTGCCTACAGGAAGACGAGACGGGCTAGTTTCCAACATTGAGCACGTGAAACTGCCAGGGCCAACATTTACAGTATCTGAAGCATTC
CAGGTTTTCAAAGCCAAAGGGCTAAACTTTGCTGATATGGTGACCCTTTTAGGTGCACACACAGTGGGAGTTGCTCATTGCAGTTTCTTTGAGGATAGGGTTTCAAATTTCCAAGGCACT
GGGAGTCCTGATCCTACAATGGATAGTAATTTAGCTGCTAATCTCAGCAAGATTTGTGGTGCTTCTAACACTGACCCAGCTGTGTTTTTGGATCAAAGCACAGGCTTTGTGTTTGATAAT
GAATACTACAAGCATCTGCTTTTGAAGAGAGGAATATTGCAGATTGATCAAGAACTCGCCATTGATAGAACTAGTATCGGAATAGTTTCGAGTTTTGCCACGAATGGGATTGGATTTAAG
CAGAGTTTTGCAAATGCAATGGTGAAACTTGGAAGTACTCAGGTTATTGTTGGAAATGCTGGAGAAGTTAGGACCAATTGTAGAGTTTTCAATGTCCAAAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAATGGAAGCTTCGTTTATATTCTTTCTTTTGGTCCTTCCCCTTGTAATGGCTGATCTAAGAGTTGGCTTTTATCAATCAACGTGTCCTCAAGCAGAATCGATAGTAAGTCAAGTG
GTGAAATATCGATTTAATACTGATCCATCCCTACCTGCAGCCTTGCTTCGCATGCATTTTCATGATTGCTTCGTTACA
GGTTGTGATGCGTCGATTCTTATAGACTCAACCAAGCAGAAA
GAATCCGAGAAAGATGCACAACCGAACCACACAGTTCGAGGGTACGAGCTAATCGACGCGATCAAGGAAGCCGTAGAGGCTGCCTGCCCTTCGATGGTCTCCTGTGCAGACATCATAACA
CTTGCAACTAGAGATGCTGTGGCTCTCGCAGGAGGCCCCAACTACACTGTGCCTACAGGAAGACGAGACGGGCTAGTTTCCAACATTGAGCACGTGAAACTGCCAGGGCCAACATTTACA
GTATCTGAAGCATTCCAGGTTTTCAAAGCCAAAGGGCTAAACTTTGCTGATATGGTGACCCTTTTAGGTGCACACACAGTGGGAGTTGCTCATTGCAGTTTCTTTGAGGATAGGGTTTCA
AATTTCCAAGGCACTGGGAGTCCTGATCCTACAATGGATAGTAATTTAGCTGCTAATCTCAGCAAGATTTGTGGTGCTTCTAACACTGACCCAGCTGTGTTTTTGGATCAAAGCACAGGC
TTTGTGTTTGATAATGAATACTACAAGCATCTGCTTTTGAAGAGAGGAATATTGCAGATTGATCAAGAACTCGCCATTGATAGAACTAGTATCGGAATAGTTTCGAGTTTTGCCACGAAT
GGGATTGGATTTAAGCAGAGTTTTGCAAATGCAATGGTGAAACTTGGAAGTACTCAGGTTATTGTTGGAAATGCTGGAGAAGTTAGGACCAATTGTAGAGTTTTCAATGTCCAAAAG

Retrieve as FASTA