Entry information : MePrx105(Manes.15G018500 / cassava4.1_028760m)
Entry ID 9065
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2019-08-22 (Christophe Dunand)
Peroxidase information: MePrx105(Manes.15G018500 / cassava4.1_028760m)
Name MePrx105(Manes.15G018500 / cassava4.1_028760m)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx105
start..stop
S start..stop
RcPrx24 469 1e-167 31..344 25..348
VvPrx[P]60 411 7e-145 1..344 1..326
LuPrx207 399 1e-139 6..344 8..348
PpePrx41 395 2e-138 56..344 36..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2228401..2228679 279 N° 2 2228113..2228304 192 N° 3 2227868..2228033 166 N° 4 2227387..2227781 395
complement(join(2227387..2227781,2227868..2228033,2228113..2228304,2228401..2228 679))


exon

Literature and cross-references MePrx105(Manes.15G018500 / cassava4.1_028760m)
DNA ref. Phytozome 12:   scaffold01551 (2228679..2227387)
Protein sequence: MePrx105(Manes.15G018500 / cassava4.1_028760m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   344 (320)
PWM (Da):   %s   37193.54 (34552.0)  
PI (pH):   %s   6.73 (6.58) Peptide Signal:   %s   cut: 25 range:25-344
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKPNNFILLFISLLLLTVLNLSSGKDHGNKGGNGDHGKKHDHNNHGQGHGNEKESSCPQLERISRDITWRRSAANPALPAKLLRMHFHDCFVRGCDASILLDSTGGTEAEKEAVPNRSLAGFEVIDEIKAKAEEECPGLVSCADIVALAARDAVAFQFRRSLWPVSFGRKDGRVSLASEANATLPSPAANFATLRQQFQSLGLDVVDLVALSGAHTIGVSHCAAFSDRIFNFTGKGDTDPSLDPDYANFLKQKCSNPPSLTTTVDMDPGSSLSFDSHYFEALFQNKGLFQSDATLLTDPEAARLSRTFQNQGAFFARFGQSMVKMGSIVSGEEGEIRKNCRVV

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCCTAATAACTTCATTCTCCTTTTCATTTCTCTCTTATTGCTGACCGTTCTCAACCTTTCCAGTGGAAAGGATCATGGAAACAAAGGTGGTAATGGTGATCATGGTAAGAAACAT
GATCATAATAATCATGGTCAGGGACATGGAAATGAAAAAGAGAGTAGTTGCCCTCAGCTTGAGAGAATTTCAAGGGACATTACATGGAGGAGATCTGCAGCTAACCCTGCCTTGCCAGCC
AAGCTATTAAGGATGCATTTTCATGATTGCTTTGTGAGG
GTATAATTATATATCTATACATGTACACTAGCTAATTTTTAACATTTATATTTGATTCTCATGAATTCTTCATCAAAATTA
TATTGGTGCATGCAGGGATGTGATGCCTCAATATTGTTGGATTCGACTGGTGGCACGGAGGCTGAGAAGGAAGCTGTTCCAAACCGATCGTTAGCAGGATTTGAGGTCATCGATGAAATA
AAAGCCAAAGCAGAAGAAGAATGCCCTGGACTTGTCTCATGTGCTGATATCGTTGCCTTGGCTGCAAGAGATGCTGTTGCTTTCCAA
GTAAGACTACAAGGATTTTAATCAATAATTATG
TATATGCACAGTAACTAAGACATATTTGGCTAAATTAAATATGCAGTTTCGAAGATCTTTATGGCCTGTTTCATTTGGGAGGAAAGATGGGAGAGTTTCTTTGGCATCTGAAGCCAATGC
AACTTTACCATCCCCAGCAGCGAACTTCGCCACCCTCCGACAACAATTTCAAAGCCTTGGGCTGGATGTTGTTGATCTTGTTGCATTGTCAG
GTCATTTTCCTTTCTCTCCTCTTCTTAA
AACTCTCTCTCTCTCTCTTTGAGCTATATCAACTGACTCATATATATATGTTTTACAGGGGCTCACACCATTGGAGTATCGCACTGTGCAGCATTTTCGGATAGGATTTTCAATTTCACG
GGGAAAGGAGACACAGATCCTTCACTTGATCCAGACTACGCAAATTTCTTGAAACAGAAATGTTCCAACCCTCCAAGTCTCACTACCACAGTTGATATGGACCCTGGAAGCTCACTCTCC
TTTGACAGCCATTACTTTGAAGCTTTATTCCAGAACAAGGGCCTATTTCAATCAGATGCCACTTTGCTCACTGACCCAGAAGCAGCTCGGCTAAGCAGGACTTTTCAAAATCAAGGGGCT
TTCTTTGCTCGCTTTGGTCAGTCAATGGTGAAAATGGGTTCAATAGTTTCAGGAGAAGAAGGAGAGATTAGGAAGAACTGCCGCGTCGTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCCTAATAACTTCATTCTCCTTTTCATTTCTCTCTTATTGCTGACCGTTCTCAACCTTTCCAGTGGAAAGGATCATGGAAACAAAGGTGGTAATGGTGATCATGGTAAGAAACAT
GATCATAATAATCATGGTCAGGGACATGGAAATGAAAAAGAGAGTAGTTGCCCTCAGCTTGAGAGAATTTCAAGGGACATTACATGGAGGAGATCTGCAGCTAACCCTGCCTTGCCAGCC
AAGCTATTAAGGATGCATTTTCATGATTGCTTTGTGAGG
GGATGTGATGCCTCAATATTGTTGGATTCGACTGGTGGCACGGAGGCTGAGAAGGAAGCTGTTCCAAACCGATCGTTAGCA
GGATTTGAGGTCATCGATGAAATAAAAGCCAAAGCAGAAGAAGAATGCCCTGGACTTGTCTCATGTGCTGATATCGTTGCCTTGGCTGCAAGAGATGCTGTTGCTTTCCAA
TTTCGAAGA
TCTTTATGGCCTGTTTCATTTGGGAGGAAAGATGGGAGAGTTTCTTTGGCATCTGAAGCCAATGCAACTTTACCATCCCCAGCAGCGAACTTCGCCACCCTCCGACAACAATTTCAAAGC
CTTGGGCTGGATGTTGTTGATCTTGTTGCATTGTCAG
GGGCTCACACCATTGGAGTATCGCACTGTGCAGCATTTTCGGATAGGATTTTCAATTTCACGGGGAAAGGAGACACAGATCCT
TCACTTGATCCAGACTACGCAAATTTCTTGAAACAGAAATGTTCCAACCCTCCAAGTCTCACTACCACAGTTGATATGGACCCTGGAAGCTCACTCTCCTTTGACAGCCATTACTTTGAA
GCTTTATTCCAGAACAAGGGCCTATTTCAATCAGATGCCACTTTGCTCACTGACCCAGAAGCAGCTCGGCTAAGCAGGACTTTTCAAAATCAAGGGGCTTTCTTTGCTCGCTTTGGTCAG
TCAATGGTGAAAATGGGTTCAATAGTTTCAGGAGAAGAAGGAGAGATTAGGAAGAACTGCCGCGTCGTTAAT

Retrieve as FASTA