Entry information : MePrx106 (cassava4.1_029175m)
Entry ID 9066
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-06 (Christophe Dunand)
Peroxidase information: MePrx106 (cassava4.1_029175m)
Name (synonym) MePrx106 (cassava4.1_029175m)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx106
start..stop
S start..stop
RcPrx10 521 0 1..328 1..327
PtPrx29 518 0 1..328 1..327
PtPrx28 518 0 1..328 1..327
PtPrx77 508 0 1..328 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 47672..47893 222 N° 2 47409..47597 189 N° 3 47163..47328 166 N° 4 46661..47067 407
complement(join(46661..47067,47163..47328,47409..47597,47672..47893))


exon

Literature and cross-references MePrx106 (cassava4.1_029175m)
DNA ref. Phytozome 11:   scaffold06906 (47893..46661)
Protein sequence: MePrx106 (cassava4.1_029175m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328
PWM (Da):   %s   36067.6 Transmb domain:   %s   i7-29o
PI (pH):   %s   9.09
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVQKMIWVLFSQMILILFFLDFTNASGLKLGFYWRSCPNADQIIKTTLNKYIRRDPTLAAPLLRMHFHDCFVRGCDGSVLLNSKRGNQAEKEAIPNQTLRGFNVIDAVKSALEKKCPGVVSCADTLALVARDAVSMIGGPFWDVKTGRRDGRVSIASEALTQLPSPFANISELKQNFAVRGLNVKDLVVLSGGHTIGIGHCFIISNRLYNFTGKGDTDPSLDPKYAAALKKKCKPGGDNKAIVEMDPGSFKTFDEDYYRIVAKRRGLFQSDAALLDDVETRAYVQLQSLTHGFTFAQDFADSMVKLGDVGVLTGCQGEIRKRCTFV

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTTCAAAAGATGATTTGGGTTTTGTTTTCTCAAATGATTCTCATTCTCTTTTTCTTAGATTTCACTAATGCAAGTGGTCTGAAACTAGGGTTCTACTGGAGGAGTTGCCCTAAT
GCAGACCAAATTATCAAAACAACTCTTAACAAATACATTAGAAGAGACCCAACTCTTGCTGCTCCTTTGTTGAGAATGCATTTCCATGATTGCTTCGTTAGG
GTAAGTTTCTTATTGCTT
CTTTGATCAAAATCAATATACATGTGAAGCCGCCATGAACATGTAGCTGTTTGCAGGGATGTGACGGTTCTGTGCTATTAAATTCAAAGAGAGGCAATCAAGCTGAGAAAGAAGCAATCC
CAAACCAAACCTTGAGAGGATTCAATGTGATTGATGCTGTGAAATCAGCACTAGAAAAGAAGTGTCCTGGTGTGGTTTCTTGCGCTGATACCTTAGCCTTAGTAGCTCGAGATGCAGTTT
CAATG
GTAACTTGATGTTACTGTATATTAAATAAGCTGATACCTTAGCATTAAGCTTAATAAAAATGCTTTAATGTTTGTTTCAGATTGGGGGACCATTTTGGGATGTTAAAACTGGACG
GAGAGATGGAAGAGTGTCAATTGCCTCGGAGGCTTTAACACAGCTGCCATCTCCTTTTGCCAACATAAGTGAGCTTAAACAAAATTTTGCTGTCAGGGGTTTAAATGTTAAGGACCTTGT
TGTTCTATCAG
GTGACTACTTTCAGTTTATATATATAATACTCTGTCTCATTCGTATTTCTACAAGGACAATGTATAACAAAAGTTATATAAATTTTGTGTTGCAGGAGGACACACCATT
GGCATTGGGCATTGCTTTATAATATCAAACCGCTTATACAATTTCACAGGCAAAGGCGACACTGACCCATCACTAGACCCCAAATACGCAGCAGCATTGAAGAAAAAGTGCAAGCCAGGA
GGAGACAACAAGGCAATTGTGGAAATGGACCCTGGAAGCTTCAAAACATTTGATGAAGATTACTACAGAATTGTGGCTAAACGAAGAGGGCTCTTCCAATCTGATGCAGCTCTTCTTGAT
GATGTTGAAACCAGAGCTTATGTCCAGCTTCAGTCTCTCACCCATGGATTCACTTTTGCTCAAGATTTTGCTGATTCAATGGTTAAACTTGGTGATGTTGGCGTCCTCACTGGCTGCCAA
GGTGAAATCAGGAAACGCTGCACTTTCGTCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTTCAAAAGATGATTTGGGTTTTGTTTTCTCAAATGATTCTCATTCTCTTTTTCTTAGATTTCACTAATGCAAGTGGTCTGAAACTAGGGTTCTACTGGAGGAGTTGCCCTAAT
GCAGACCAAATTATCAAAACAACTCTTAACAAATACATTAGAAGAGACCCAACTCTTGCTGCTCCTTTGTTGAGAATGCATTTCCATGATTGCTTCGTTAGG
GGATGTGACGGTTCTGTG
CTATTAAATTCAAAGAGAGGCAATCAAGCTGAGAAAGAAGCAATCCCAAACCAAACCTTGAGAGGATTCAATGTGATTGATGCTGTGAAATCAGCACTAGAAAAGAAGTGTCCTGGTGTG
GTTTCTTGCGCTGATACCTTAGCCTTAGTAGCTCGAGATGCAGTTTCAATG
ATTGGGGGACCATTTTGGGATGTTAAAACTGGACGGAGAGATGGAAGAGTGTCAATTGCCTCGGAGGCT
TTAACACAGCTGCCATCTCCTTTTGCCAACATAAGTGAGCTTAAACAAAATTTTGCTGTCAGGGGTTTAAATGTTAAGGACCTTGTTGTTCTATCAG
GAGGACACACCATTGGCATTGGG
CATTGCTTTATAATATCAAACCGCTTATACAATTTCACAGGCAAAGGCGACACTGACCCATCACTAGACCCCAAATACGCAGCAGCATTGAAGAAAAAGTGCAAGCCAGGAGGAGACAAC
AAGGCAATTGTGGAAATGGACCCTGGAAGCTTCAAAACATTTGATGAAGATTACTACAGAATTGTGGCTAAACGAAGAGGGCTCTTCCAATCTGATGCAGCTCTTCTTGATGATGTTGAA
ACCAGAGCTTATGTCCAGCTTCAGTCTCTCACCCATGGATTCACTTTTGCTCAAGATTTTGCTGATTCAATGGTTAAACTTGGTGATGTTGGCGTCCTCACTGGCTGCCAAGGTGAAATC
AGGAAACGCTGCACTTTCGTCAAT

Retrieve as FASTA