Entry information : MePrx124 ( cassava4.1_031145m)
Entry ID 9082
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-27 (Christophe Dunand)
Peroxidase information: MePrx124 ( cassava4.1_031145m)
Name (synonym) MePrx124 ( cassava4.1_031145m)
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx124
start..stop
S start..stop
JcPrx01 564 0 10..340 5..334
RcPrx14 563 0 1..340 1..339
PtPrx37 526 0 1..338 1..336
QrobPrx02 510 0 26..339 23..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 193663..193917 255 N° 2 193085..193264 180 N° 3 192713..192872 160 N° 4 192095..192519 425
complement(join(192095..192519,192713..192872,193085..193264,193663..193917))


exon

Literature and cross-references MePrx124 ( cassava4.1_031145m)
DNA ref. Phytozome 11:   scaffold05280 (193917..192095)
Protein sequence: MePrx124 ( cassava4.1_031145m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340 (312)
PWM (Da):   %s   37543.07 (34495.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.18 (8.18) Peptide Signal:   %s   cut: 29 range:29-340
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRKTESVMTFSPLVVLALSLFTIAIVEAAVTLQPPVKLQWQYYKRNTSCPDAEVYIRHQIEQYWKQDKSITPKLLRLLYSDCFVTGCDASILLDGPNSEKTAPQNRGLGGFALIDKIKQVLEQRCPGVVSCADILNLATRDAVHLAGAPSYPVYTGRRDGMSSSSASVDLPSPSIPLSKALAYFKSKGLDVLDFATLLGAHSLGKTHCSFVEDRLYNFGNTGKPDPNMDPAFAAEMRKLCPPRTKKGQSDPLVFLNPESGSNYKFTETFYQGVLSYKSVLGVDQQLLFSNDTLDITQEFAANFEDMRRSFALSMNRMGNIDVLTGYAGEIRRNCRVVNK

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Containing motif 'YSDC'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAAAAACAGAAAGTGTTATGACGTTTTCCCCTCTGGTGGTTCTTGCATTAAGCTTGTTTACTATAGCAATTGTGGAGGCGGCAGTGACGCTGCAGCCACCGGTGAAGCTGCAGTGG
CAGTATTACAAGAGGAACACCTCATGCCCTGATGCAGAGGTGTACATAAGGCATCAAATAGAGCAGTATTGGAAACAAGATAAATCCATTACTCCAAAGCTTCTCCGGCTGCTCTACTCA
GATTGCTTTGTTACT
GTAAGTCCTTGTAAATCTCTCCTTTGCCTACCTTTTATTTATTCTAATCACTGGTGACTAAAATTGTTAGCTATCAATCTAGAAGAGCAAGGAACATTTAAATAA
ATGAAGGTTTAGTTTTTTCTCAAATAAAGTGTGTGCATCTAATACAAACTCGATGATATCATAGAAGAACGAGTTTAATAACTATTAGATCAAAAGTATATGTATCTAAATTTGTGCAGA
ATCAATTAAAATATATATAATGAATGCATAAATCTATATGCAAACATTTAATTACTGATTATCAAATTTATTCTCATATGAATTCATGCTCAGTTTTACCTTATAAACTCATAAAGGTCA
ATTGTTCATGTTTCTTCTCTGGCTAAAACCATAATAATTTGACACAAATTCAGGGCTGCGATGCATCAATTCTTCTTGATGGACCAAACTCAGAGAAAACTGCACCACAGAACAGAGGTC
TGGGTGGATTTGCACTCATAGACAAGATCAAACAAGTTCTTGAACAAAGGTGCCCTGGAGTTGTCTCTTGTGCTGATATTCTTAACCTAGCTACCAGGGATGCTGTTCATTTG
GTATGAA
ATCTTCCACATCCTACCTTTATTCATACAAAAAAATAACTGGGGAAAATTTCCCAGTAATTTTACTCCAAAAAATCCAAATACTTCAAAGGAAAAACATATCAAATCAAGATTTATCAAA
TCAATGCAAATTTAGAATTTGGCTACTGTATGAACTAGACTAAAAATTTCATGACTTGTGTTTAATGATCTAATGAAACATACAGGCAGGTGCACCATCTTATCCTGTATACACAGGAAG
AAGGGATGGGATGTCGTCAAGCTCAGCATCAGTAGACCTCCCATCACCGTCCATCCCATTATCGAAGGCATTGGCTTATTTCAAATCTAAAGGCTTAGATGTGCTAGATTTTGCTACCCT
CTTAG
GTATGAATCTAATTTCACCAGAAAATATATACAACCTATTCTACTCTGCAAAATCATGATGCTAAAAGCTAAGCAATTTTTCCAATGGATCTCCTAGTTAGGTTAACAATGTTAG
TATCCAACCATCCTATATGCCCTGTTCAATATGATCCTGCACATTTTCTGGTCGAATAAGCGTGTTTGTGTACAACAGGGGCACACTCATTGGGAAAAACACACTGCAGCTTTGTTGAGG
ACCGGTTGTACAATTTCGGTAATACAGGAAAGCCAGATCCAAACATGGACCCAGCATTTGCAGCTGAGATGAGAAAGCTATGTCCACCCAGAACCAAAAAGGGCCAATCTGATCCTCTGG
TGTTTCTAAATCCTGAATCTGGCTCTAACTACAAATTCACAGAGACTTTCTACCAGGGGGTTTTGTCCTACAAATCTGTCCTTGGAGTTGACCAGCAGCTGCTATTCAGTAATGACACAT
TAGACATAACACAAGAATTTGCTGCTAATTTTGAAGACATGAGGAGATCATTTGCGCTGTCAATGAATCGGATGGGAAATATCGATGTTCTAACAGGATATGCAGGGGAGATACGGCGAA
ATTGCCGGGTCGTCAACAAGAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAAAAACAGAAAGTGTTATGACGTTTTCCCCTCTGGTGGTTCTTGCATTAAGCTTGTTTACTATAGCAATTGTGGAGGCGGCAGTGACGCTGCAGCCACCGGTGAAGCTGCAGTGG
CAGTATTACAAGAGGAACACCTCATGCCCTGATGCAGAGGTGTACATAAGGCATCAAATAGAGCAGTATTGGAAACAAGATAAATCCATTACTCCAAAGCTTCTCCGGCTGCTCTACTCA
GATTGCTTTGTTACT
GGCTGCGATGCATCAATTCTTCTTGATGGACCAAACTCAGAGAAAACTGCACCACAGAACAGAGGTCTGGGTGGATTTGCACTCATAGACAAGATCAAACAAGTT
CTTGAACAAAGGTGCCCTGGAGTTGTCTCTTGTGCTGATATTCTTAACCTAGCTACCAGGGATGCTGTTCATTTG
GCAGGTGCACCATCTTATCCTGTATACACAGGAAGAAGGGATGGG
ATGTCGTCAAGCTCAGCATCAGTAGACCTCCCATCACCGTCCATCCCATTATCGAAGGCATTGGCTTATTTCAAATCTAAAGGCTTAGATGTGCTAGATTTTGCTACCCTCTTAG
GGGCA
CACTCATTGGGAAAAACACACTGCAGCTTTGTTGAGGACCGGTTGTACAATTTCGGTAATACAGGAAAGCCAGATCCAAACATGGACCCAGCATTTGCAGCTGAGATGAGAAAGCTATGT
CCACCCAGAACCAAAAAGGGCCAATCTGATCCTCTGGTGTTTCTAAATCCTGAATCTGGCTCTAACTACAAATTCACAGAGACTTTCTACCAGGGGGTTTTGTCCTACAAATCTGTCCTT
GGAGTTGACCAGCAGCTGCTATTCAGTAATGACACATTAGACATAACACAAGAATTTGCTGCTAATTTTGAAGACATGAGGAGATCATTTGCGCTGTCAATGAATCGGATGGGAAATATC
GATGTTCTAACAGGATATGCAGGGGAGATACGGCGAAATTGCCGGGTCGTCAACAAGAAA

Retrieve as FASTA