Entry information : MePrx133 ( cassava4.1_031946m)
Entry ID 9090
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-24 (Christophe Dunand)
Peroxidase information: MePrx133 ( cassava4.1_031946m)
Name (synonym) MePrx133 ( cassava4.1_031946m)
Class Class III peroxidase    [Orthogroup: Prx020]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx133
start..stop
S start..stop
RcPrx06 573 0 20..324 25..329
MePrx03 557 0 21..322 25..326
EgrPrx68 540 0 10..324 11..325
EglPrx68 540 0 10..324 11..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 83207..83410 204 N° 2 82920..83117 198 N° 3 81166..81331 166 N° 4 80584..80987 404
complement(join(80584..80987,81166..81331,82920..83117,83207..83410))


exon

Literature and cross-references MePrx133 ( cassava4.1_031946m)
DNA ref. Phytozome 12:   scaffold03995 (83410..80584)
Protein sequence: MePrx133 ( cassava4.1_031946m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (303)
PWM (Da):   %s   35584.4 (33261.0)  
PI (pH):   %s   9.5 (9.50) Peptide Signal:   %s   cut: 22 range:22-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNFLVLPFLLLFPLLLPIASAQLRQNFYSQTCPNVESIVRSVVQQKFQQTFVTAPATLRLFFHDCFVRGCDASVLIASPTNNAEKDHPDNLSLAGDGFDTVIKAKAAVDSVPQCRNKVSCADILALATRDVVALAGGPFYTVELGRRDGRISTKASVQRKLPSPNFNLDHLNSMFASHGLTQTDIIALSGAHTLGFSHCSRFSKRIYNFSPRNRIDPTLNLQYALELRQMCPIKVDPRIAINMDPTTPQKFDNAYYGNLVQGKGLFSSDQILFTDPRSRPTVQLFASNNAAFQNAFVAAITKLGRVGVLTGNHGEIRKDCARI

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACTTTCTAGTTCTACCCTTTCTTCTTCTCTTCCCTCTCCTTCTTCCTATTGCTTCTGCTCAACTTAGACAGAACTTCTATAGCCAAACATGTCCTAACGTAGAATCTATAGTTCGT
TCTGTAGTCCAGCAAAAGTTCCAGCAAACTTTTGTGACTGCCCCTGCAACTCTTCGGCTCTTCTTCCACGATTGTTTTGTGAGG
GTTAGTTCTCTTTCTTTTTTTAATTAGACGTTCAGA
AATAAAAGTTTGAACTCAAAACTTGTTAGCTTTTTCTTTTGTTGTTGAAATAGGGATGTGATGCTTCGGTTTTGATAGCTTCGCCGACTAACAATGCTGAGAAGGATCACCCGGATAATC
TTTCACTTGCCGGAGATGGGTTCGACACGGTGATCAAGGCAAAGGCTGCCGTTGATAGTGTTCCTCAATGCAGGAATAAAGTTTCATGTGCTGATATACTAGCTCTTGCAACTAGGGACG
TTGTAGCCTTG
GTATGCATTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTACAAGTTAAATAGTAAGGTTTTGAATTCAACTCAATATGAAATATTTAAATGCACATCTAACTT
AATTTTACANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCTCTTCTTTCCGT
TAATAAAATAGTTTTTTCATCTATTTCTACGGTTAAAAATATAGCAAAAGTTTAAATTACCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNTTTTTATTGAGGAGGAAAGACTATTTCTTTGACAGGAAGAAACGATAAGAACGTTTTAATAGATTTGAAAAAAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGGAGTTTTATTTGTGGAAAAAATTAGGTTTTAAAAATTTTTCTTTTATCTCTCATATATTTTTAATGGATAAAAGA
ATGGCAAGATTATTTCGAGAGAAAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTTCTTTTATAATGT
AGAGGTAAATTTACCCTTTAGCTAATTTTTTATTTATCACTTATATATCATAAGATTTTGATAGAATTTCACATATGAAACGAAAATCGACAAAAGGTTTCCTAATATAAATTTGCAATT
AAAAGTAGGCTATATCACTAGCNNNNNNNNNNNNNNNNNNNNNNNNNNCATCGAAATAAAAACCCAAAGTAATTAATTAAAGTAAGTGCATGTAAATTTGAGNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTGATGAAATTAATTTGTAAAAAATCCTTGTAATTTTGTGATGTTAAGTTGTCCC
TTTAGGAATGGAAGTTTGCATACGTTGGCTAGTATTAATTGCTTATCCTATAAAGTAATAACATACAAACAGTTTGCNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTCAACTACTCCATG
TGCATGATTGATATTAATTAATATGTGGAATATTTTTAGGCAGGAGGACCTTTTTATACAGTAGAATTGGGGAGACGTGATGGGAGAATATCTACAAAGGCAAGTGTTCAACGTAAGCTG
CCAAGTCCTAACTTCAACTTAGACCACCTCAATTCCATGTTTGCTTCACATGGCCTTACCCAAACTGACATCATCGCTTTATCAG
GTGCCTAAACTTTTCAGTCTAATTTTTTAAGATAG
AGCAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATAAAAGAAAGGGATTGTTTCAGTGTCTAACAACAG
TGTGTGAATAATATTTGCTATAGGTGCACATACACTTGGGTTTTCACATTGCAGCAGGTTCTCCAAGAGAATTTACAACTTCAGTCCAAGAAACAGGATTGACCCGACACTCAATCTTCA
ATATGCACTTGAGCTAAGGCAAATGTGTCCTATAAAAGTAGATCCAAGAATTGCAATTAACATGGATCCAACTACCCCTCAGAAATTTGACAATGCCTACTATGGAAACCTTGTACAAGG
AAAAGGGTTGTTTAGCTCAGACCAGATCCTGTTTACTGATCCAAGATCAAGACCCACTGTCCAACTCTTTGCTTCAAATAATGCAGCTTTTCAGAATGCTTTTGTGGCTGCCATCACCAA
GCTTGGCAGAGTTGGCGTCTTGACGGGAAACCATGGTGAAATTAGGAAAGATTGTGCCCGCATCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACTTTCTAGTTCTACCCTTTCTTCTTCTCTTCCCTCTCCTTCTTCCTATTGCTTCTGCTCAACTTAGACAGAACTTCTATAGCCAAACATGTCCTAACGTAGAATCTATAGTTCGT
TCTGTAGTCCAGCAAAAGTTCCAGCAAACTTTTGTGACTGCCCCTGCAACTCTTCGGCTCTTCTTCCACGATTGTTTTGTGAGG
GGATGTGATGCTTCGGTTTTGATAGCTTCGCCGACT
AACAATGCTGAGAAGGATCACCCGGATAATCTTTCACTTGCCGGAGATGGGTTCGACACGGTGATCAAGGCAAAGGCTGCCGTTGATAGTGTTCCTCAATGCAGGAATAAAGTTTCATGT
GCTGATATACTAGCTCTTGCAACTAGGGACGTTGTAGCCTTG
GCAGGAGGACCTTTTTATACAGTAGAATTGGGGAGACGTGATGGGAGAATATCTACAAAGGCAAGTGTTCAACGTAAG
CTGCCAAGTCCTAACTTCAACTTAGACCACCTCAATTCCATGTTTGCTTCACATGGCCTTACCCAAACTGACATCATCGCTTTATCAG
GTGCACATACACTTGGGTTTTCACATTGCAGC
AGGTTCTCCAAGAGAATTTACAACTTCAGTCCAAGAAACAGGATTGACCCGACACTCAATCTTCAATATGCACTTGAGCTAAGGCAAATGTGTCCTATAAAAGTAGATCCAAGAATTGCA
ATTAACATGGATCCAACTACCCCTCAGAAATTTGACAATGCCTACTATGGAAACCTTGTACAAGGAAAAGGGTTGTTTAGCTCAGACCAGATCCTGTTTACTGATCCAAGATCAAGACCC
ACTGTCCAACTCTTTGCTTCAAATAATGCAGCTTTTCAGAATGCTTTTGTGGCTGCCATCACCAAGCTTGGCAGAGTTGGCGTCTTGACGGGAAACCATGGTGAAATTAGGAAAGATTGT
GCCCGCATCAAC

Retrieve as FASTA