Entry information : MePrx20 (cassava4.1_011653m)
Entry ID 9100
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2012-01-05 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-11-30 (Qiang Li)
Peroxidase information: MePrx20 (cassava4.1_011653m)
Name (synonym) MePrx20 (cassava4.1_011653m)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx20
start..stop
S start..stop
RcPrx52 567 0 11..329 1..317
PtPrx40 506 0 11..329 45..360
CclPrx113 492 2e-177 11..329 1..318
PpePrx51 475 2e-170 11..329 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 93531..93773 243 N° 2 93865..94059 195 N° 3 94479..94644 166 N° 4 94747..95129 383
join(93531..93773,93865..94059,94479..94644,94747..95129)


exon

Literature and cross-references MePrx20 (cassava4.1_011653m)
DNA ref. Phytozome 12:   scaffold04265 (93531..95129)
Protein sequence: MePrx20 (cassava4.1_011653m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329
PWM (Da):   %s   34407.88 Transmb domain:   %s   i7-29o
PI (pH):   %s   6.76
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHLSSFYYYNMAFSSQIYGLYLFMLxxxxxxxxAQLSSNYYATTCPKALSTIKIAVLKAVAKEHRLGASLLRMHFHDCFVNGCDASILLDDVSPSFKGEKTAGPNANSLRGFEVIDSIKSQVESICPGVVSCADIIAVAARDSVAALGGPSWQVELGRRDSTTASYSAANTELPSPLMDLSDLISSFSNKGFTAKDMVALSGAHTTGQARCSMFRGRLYNETNIDSTLATSLKSSCPSTGSDTNFSPLDATSPVIFDNAYFTNLVNNKGLLHSDQQLFSGGSTDSQVKTYSTNPITFYADFANAMVKMGKLSPLTGTEGEIRTDCRKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCACCTTTCTTCATTTTATTATTATAATATGGCATTTTCCTCACAAATATATGGATTGTATTTGTTCATGCTTTTNNNNNNNNNNNNNNNNNNNNATGCACAATTATCTTCCAATTAC
TATGCCACAACATGCCCAAAAGCTCTTTCTACCATCAAAATTGCTGTGCTTAAAGCTGTTGCAAAGGAGCATCGCCTGGGAGCATCTTTGCTTCGTATGCATTTCCATGACTGCTTTGTT
AAT
GTACTCTTTTCTCTCTCTCCCCCCACACACTAAATATCAATAATAATTATGGATGTTATTAATGAAGTTGTATGTGTATTGGCTGAAACAGGGATGTGATGCATCTATTTTATTAGA
TGATGTCTCCCCAAGTTTCAAAGGTGAGAAGACTGCAGGCCCAAATGCAAATTCTCTTAGAGGCTTTGAAGTGATCGATTCAATTAAATCTCAAGTGGAGTCTATTTGCCCTGGAGTTGT
TTCTTGTGCTGATATTATAGCTGTTGCTGCTCGTGATTCAGTTGCTGCT
GTAAGTAATTCTAATGGAATTCTCTATATATTATTTATTCTTTTAAAATGGTGGATATAATTCCTTATATA
ATGGAACATTCTAACACCATGCTTCTGATAGGAGAATTATCAATTCGCAAAATATTAAAATGACTAGTGCTTCAATTTTACCAAGTATTTATCCAAGATATTCAAGTGCATTTTAAATTT
CTTTAATCCAAATTAACCTAAAAGTTCAAATTATACTCAAACAAGGATCGACTCCTATCTCCACCTATTGACAAAAGGACTACGATATTGACTGAAATGGTAGAGGCTGTATATATCCAA
CGAATTTGACAATTTGAAAAGCATGAATTCTAAAGTAATTTCCATCGAGAAAAAGAAAATATATTTCAACTCAATTGGGTTAACAAAAAAGTAAGAATTTTTATCCAGTTGGGTGGTCCT
TCATGGCAAGTTGAATTGGGTAGAAGAGATTCCACCACTGCAAGTTATAGTGCTGCAAATACTGAGCTTCCATCCCCACTAATGGACCTCAGCGACCTTATATCTTCCTTCTCAAATAAA
GGCTTCACTGCCAAAGATATGGTCGCTCTTTCAG
GCAAGATAACCATATAAAACGCTTGTCAAATGTCAACTGTTGTATTATCACTTCAGATTTTGGTTTCTGCAAACTAATTTCTATTG
TTTTCATGATTAATAGGAGCTCACACAACAGGCCAAGCCAGGTGCTCGATGTTTCGAGGCCGACTCTACAATGAGACAAACATAGATTCAACACTGGCAACATCATTAAAATCAAGCTGT
CCAAGTACAGGCAGCGACACGAATTTCTCTCCACTAGATGCTACTAGCCCTGTAATATTTGATAATGCCTATTTCACCAATTTGGTTAACAACAAAGGCCTTCTGCACTCAGATCAGCAG
CTTTTTAGTGGTGGCTCCACCGATTCGCAGGTAAAAACCTACAGCACCAATCCTATTACTTTCTATGCAGATTTTGCCAACGCAATGGTCAAGATGGGGAAACTCAGTCCACTCACAGGA
ACCGAGGGAGAGATTCGCACTGACTGCCGGAAAGTTAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCACCTTTCTTCATTTTATTATTATAATATGGCATTTTCCTCACAAATATATGGATTGTATTTGTTCATGCTTTTNNNNNNNNNNNNNNNNNNNNATGCACAATTATCTTCCAATTAC
TATGCCACAACATGCCCAAAAGCTCTTTCTACCATCAAAATTGCTGTGCTTAAAGCTGTTGCAAAGGAGCATCGCCTGGGAGCATCTTTGCTTCGTATGCATTTCCATGACTGCTTTGTT
AAT
GGATGTGATGCATCTATTTTATTAGATGATGTCTCCCCAAGTTTCAAAGGTGAGAAGACTGCAGGCCCAAATGCAAATTCTCTTAGAGGCTTTGAAGTGATCGATTCAATTAAATCT
CAAGTGGAGTCTATTTGCCCTGGAGTTGTTTCTTGTGCTGATATTATAGCTGTTGCTGCTCGTGATTCAGTTGCTGCT
TTGGGTGGTCCTTCATGGCAAGTTGAATTGGGTAGAAGAGAT
TCCACCACTGCAAGTTATAGTGCTGCAAATACTGAGCTTCCATCCCCACTAATGGACCTCAGCGACCTTATATCTTCCTTCTCAAATAAAGGCTTCACTGCCAAAGATATGGTCGCTCTT
TCAG
GAGCTCACACAACAGGCCAAGCCAGGTGCTCGATGTTTCGAGGCCGACTCTACAATGAGACAAACATAGATTCAACACTGGCAACATCATTAAAATCAAGCTGTCCAAGTACAGGC
AGCGACACGAATTTCTCTCCACTAGATGCTACTAGCCCTGTAATATTTGATAATGCCTATTTCACCAATTTGGTTAACAACAAAGGCCTTCTGCACTCAGATCAGCAGCTTTTTAGTGGT
GGCTCCACCGATTCGCAGGTAAAAACCTACAGCACCAATCCTATTACTTTCTATGCAGATTTTGCCAACGCAATGGTCAAGATGGGGAAACTCAGTCCACTCACAGGAACCGAGGGAGAG
ATTCGCACTGACTGCCGGAAAGTTAAC

Retrieve as FASTA