Entry information : MePrx23 (cassava4.1_011738m)
Entry ID 9102
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: MePrx23 (cassava4.1_011738m)
Name (synonym) MePrx23 (cassava4.1_011738m)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx23
start..stop
S start..stop
MePrx01 611 0 1..327 1..331
RcPrx17 594 0 1..326 1..330
LcPrx03 594 0 1..327 1..332
CclPrx35 585 0 1..326 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1698259..1698471 213 N° 2 1698617..1698808 192 N° 3 1698903..1699068 166 N° 4 1699134..1699543 410
join(1698259..1698471,1698617..1698808,1698903..1699068,1699134..1699543)


exon

Literature and cross-references MePrx23 (cassava4.1_011738m)
DNA ref. Phytozome 12:   scaffold07520 (1698259..1699543)
Protein sequence: MePrx23 (cassava4.1_011738m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (304)
PWM (Da):   %s   35672.28 (33217.0) Transmb domain:   %s   i5-27o
PI (pH):   %s   9.69 (9.69) Peptide Signal:   %s   cut: 24 range:24-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAQSVSFLLVLTTLLAFAPFTFGGHLYPQFYDHSCPKAQQIVKSIVAKAVAKEARMAASLLRLHFHDCFVKGCDASLLLDSSGSIVSEKRSNPNRNSARGFEVIDEIKTALEKECPQTVSCADILALAARDSTVLTGGPSWKVPLGRKDSRGASLSGSNNNIPAPNNTFQTILTKFKLNGLNVVDLVALSGSHTIGNSRCTSFRQRLYNQSGNGQPDYTLHPSYAAQLRTRCPRSGGDQNLFVLDFVSPTKFDNSYFKDILASKGLLNSDQVLLTKSEASMDLVKKYAENNELFFEQFAKSMIKMGNVSPLTGPRGEVRKNCRKIN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCAATCTGTAAGCTTTCTCTTAGTTCTTACTACTCTCCTTGCCTTTGCTCCTTTTACCTTTGGTGGCCACCTCTACCCACAGTTCTATGACCATTCCTGCCCTAAAGCTCAACAG
ATAGTCAAGTCTATTGTAGCCAAGGCAGTAGCAAAAGAAGCTCGCATGGCTGCCTCATTACTTAGACTTCATTTTCATGACTGTTTTGTCAAG
GTCTGTCTGTCACCTTCCTAAAATTCC
CGTCACTGCTTGTATAGTTACCTGTGCTCTAGCTAAAATGCTCACATCAGGTTTTGGACGTGTAATGGCTTGTGTCAATCTTTCTGACAACTTACAAATGTAAGCTCTTCCATTGCAGGG
GTGTGATGCATCATTGTTGTTAGACAGCAGTGGAAGCATAGTCAGTGAGAAGAGGTCTAATCCGAACCGAAACTCAGCTCGAGGATTCGAAGTAATTGATGAGATCAAAACTGCACTAGA
GAAAGAGTGTCCTCAAACTGTATCTTGTGCTGATATTCTGGCCTTGGCTGCTAGAGATTCAACTGTTCTT
GTAAGTGCACTTCCTTGTCTCTGTAGCAAAATTAAACAACTGGCAGTGAT
AGCTAATAAAAATCTTGACTTCACCATCTTTTTCATTTGCACAGACTGGAGGACCTAGCTGGAAGGTTCCGCTCGGAAGGAAGGACTCCAGAGGTGCAAGCCTGAGTGGTTCTAACAACA
ACATTCCTGCTCCAAATAACACATTTCAAACCATTCTTACCAAGTTCAAGCTTAATGGCCTCAACGTCGTTGATCTCGTAGCACTATCCG
GTAACCAAATGGTTCATGCTTCCTTCTAAA
AGTGGCTTGCTAATATTTCCATGAATTTCTGGCAGGAAGTCACACAATCGGAAATTCTCGATGCACCAGCTTCAGGCAGAGGCTGTACAACCAATCAGGCAATGGGCAACCTGACTACAC
ACTGCATCCATCATATGCTGCACAATTGCGCACCCGCTGCCCCAGATCTGGAGGTGATCAAAACCTGTTTGTCTTGGACTTTGTAAGTCCAACAAAGTTTGATAATAGCTATTTTAAGGA
CATATTGGCTTCAAAGGGCCTGTTGAATTCTGATCAAGTTCTCCTTACAAAGAGTGAAGCATCCATGGACCTGGTCAAGAAATATGCTGAGAACAACGAACTCTTCTTTGAGCAGTTTGC
TAAGTCGATGATTAAGATGGGAAACGTCTCTCCATTGACAGGTCCTAGGGGAGAGGTTAGGAAGAATTGCAGGAAAATTAATACT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCAATCTGTAAGCTTTCTCTTAGTTCTTACTACTCTCCTTGCCTTTGCTCCTTTTACCTTTGGTGGCCACCTCTACCCACAGTTCTATGACCATTCCTGCCCTAAAGCTCAACAG
ATAGTCAAGTCTATTGTAGCCAAGGCAGTAGCAAAAGAAGCTCGCATGGCTGCCTCATTACTTAGACTTCATTTTCATGACTGTTTTGTCAAG
GGGTGTGATGCATCATTGTTGTTAGAC
AGCAGTGGAAGCATAGTCAGTGAGAAGAGGTCTAATCCGAACCGAAACTCAGCTCGAGGATTCGAAGTAATTGATGAGATCAAAACTGCACTAGAGAAAGAGTGTCCTCAAACTGTATCT
TGTGCTGATATTCTGGCCTTGGCTGCTAGAGATTCAACTGTTCTT
ACTGGAGGACCTAGCTGGAAGGTTCCGCTCGGAAGGAAGGACTCCAGAGGTGCAAGCCTGAGTGGTTCTAACAAC
AACATTCCTGCTCCAAATAACACATTTCAAACCATTCTTACCAAGTTCAAGCTTAATGGCCTCAACGTCGTTGATCTCGTAGCACTATCCG
GAAGTCACACAATCGGAAATTCTCGATGC
ACCAGCTTCAGGCAGAGGCTGTACAACCAATCAGGCAATGGGCAACCTGACTACACACTGCATCCATCATATGCTGCACAATTGCGCACCCGCTGCCCCAGATCTGGAGGTGATCAAAAC
CTGTTTGTCTTGGACTTTGTAAGTCCAACAAAGTTTGATAATAGCTATTTTAAGGACATATTGGCTTCAAAGGGCCTGTTGAATTCTGATCAAGTTCTCCTTACAAAGAGTGAAGCATCC
ATGGACCTGGTCAAGAAATATGCTGAGAACAACGAACTCTTCTTTGAGCAGTTTGCTAAGTCGATGATTAAGATGGGAAACGTCTCTCCATTGACAGGTCCTAGGGGAGAGGTTAGGAAG
AATTGCAGGAAAATTAATACT

Retrieve as FASTA