Entry information : MePrx29 (cassava4.1_011804m)
Entry ID 9108
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: MePrx29 (cassava4.1_011804m)
Name (synonym) MePrx29 (cassava4.1_011804m)
Class Class III peroxidase     [Orthogroup: Prx014]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx29
start..stop
S start..stop
RcPrx85 496 4e-179 1..325 1..320
MePrx116 468 6e-168 1..325 1..326
RcPrx77 457 9e-164 11..325 10..323
MePrx109 454 2e-162 1..325 1..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 167387..167608 222 N° 2 167112..167303 192 N° 3 166855..167020 166 N° 4 166380..166774 395
complement(join(166380..166774,166855..167020,167112..167303,167387..167608))


exon

Literature and cross-references MePrx29 (cassava4.1_011804m)
DNA ref. Phytozome 11:   scaffold07035 (167608..166380)
Protein sequence: MePrx29 (cassava4.1_011804m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (298)
PWM (Da):   %s   34674.31 (31800.9) Transmb domain:   %s   i5-27o
PI (pH):   %s   7.6 (7.69) Peptide Signal:   %s   cut: 28 range:28-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSLSLITFMALTILVMTFSCIPCQAQLSSTFYDRTCPSALSIIKGAVSAAVSRERRMAASLLRLHFHDCFVQGCDGSVLLDDTPSMTGEKNSLNNANSIRGFNVIENVKSQVESRCPGIVSCADIVAVAARDASVAAGGPSWTVKLGRRDSLTASGDLADQNLPRFTNTLSELTSSFSRKNLNQRDLVALSGAHTIGQSRCFSFRARVNSNASDIDPEFARSLREDLPCPADGSGNSNLAPLDLVTPNAFDNSFFRNLVNKKGLLQSDQVLFSGGATDSIVNQYVRDSSIFRSDFAAAMVKMGDLSPLTGSQGEIRKVCNVV

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTAGCTTATCTTTAATTACTTTCATGGCTCTCACAATATTAGTGATGACCTTCTCATGCATCCCATGTCAAGCACAGCTTTCTTCAACCTTCTATGACAGGACATGTCCTTCT
GCTTTAAGCATTATAAAGGGTGCTGTTAGTGCAGCTGTGTCCCGTGAGCGGAGAATGGCTGCTTCCCTCCTTCGCCTTCATTTCCATGATTGCTTTGTTCAA
GTAAAAATCACTTGTTGT
GTTTTGTAATTATCACATGCCAAGTTCTTGAGATCCCAAGTTCCTAATTTTGTGTATTAATGCAGGGTTGCGATGGCTCGGTGTTGCTGGACGATACTCCCTCAATGACTGGCGAGAAAA
ATTCACTCAATAATGCCAATTCTATCAGAGGATTTAATGTCATTGAAAATGTCAAGTCTCAAGTGGAGAGTCGATGTCCTGGAATTGTTTCATGTGCTGACATCGTTGCAGTGGCTGCTC
GCGATGCATCTGTTGCT
GTAAGAATTAACTTTCATCTCTTTATCAATCGAGCTTTGAGAAATATATACATCCATTTATTATATCAATGGCCTGTATCGATAACCGCAGGCCGGAGGACCA
TCATGGACAGTGAAGCTTGGAAGAAGAGACTCCCTCACTGCAAGCGGAGACCTTGCTGATCAAAACCTTCCTCGCTTTACAAATACTCTCAGTGAACTCACTTCCTCGTTCAGTAGGAAG
AATCTGAATCAAAGAGATTTGGTTGCCCTTTCAG
GTTGGTTACACAAGAAATAAAATTATTTTCAGTTGTATGTAACTATATTTAGATGGCTAACGGTTTCATTTGTGAATCAGGAGCAC
ATACAATTGGCCAATCAAGATGTTTCAGCTTCCGTGCTAGAGTTAACAGCAATGCAAGTGATATTGATCCTGAGTTTGCTAGGTCTCTGAGGGAAGATCTTCCGTGCCCTGCTGATGGTT
CTGGAAATTCAAACCTTGCACCACTTGATTTAGTGACTCCCAATGCTTTTGATAACAGCTTCTTCAGGAATCTTGTTAACAAGAAGGGACTTCTTCAATCAGATCAGGTTCTTTTCAGTG
GTGGTGCTACGGACAGCATTGTCAATCAGTACGTCAGGGACTCTTCAATCTTCAGGTCTGATTTTGCAGCTGCCATGGTAAAGATGGGAGATTTAAGCCCCTTGACTGGTTCTCAAGGAG
AGATAAGAAAAGTTTGCAATGTTGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTAGCTTATCTTTAATTACTTTCATGGCTCTCACAATATTAGTGATGACCTTCTCATGCATCCCATGTCAAGCACAGCTTTCTTCAACCTTCTATGACAGGACATGTCCTTCT
GCTTTAAGCATTATAAAGGGTGCTGTTAGTGCAGCTGTGTCCCGTGAGCGGAGAATGGCTGCTTCCCTCCTTCGCCTTCATTTCCATGATTGCTTTGTTCAA
GGTTGCGATGGCTCGGTG
TTGCTGGACGATACTCCCTCAATGACTGGCGAGAAAAATTCACTCAATAATGCCAATTCTATCAGAGGATTTAATGTCATTGAAAATGTCAAGTCTCAAGTGGAGAGTCGATGTCCTGGA
ATTGTTTCATGTGCTGACATCGTTGCAGTGGCTGCTCGCGATGCATCTGTTGCT
GCCGGAGGACCATCATGGACAGTGAAGCTTGGAAGAAGAGACTCCCTCACTGCAAGCGGAGACCTT
GCTGATCAAAACCTTCCTCGCTTTACAAATACTCTCAGTGAACTCACTTCCTCGTTCAGTAGGAAGAATCTGAATCAAAGAGATTTGGTTGCCCTTTCAG
GAGCACATACAATTGGCCAA
TCAAGATGTTTCAGCTTCCGTGCTAGAGTTAACAGCAATGCAAGTGATATTGATCCTGAGTTTGCTAGGTCTCTGAGGGAAGATCTTCCGTGCCCTGCTGATGGTTCTGGAAATTCAAAC
CTTGCACCACTTGATTTAGTGACTCCCAATGCTTTTGATAACAGCTTCTTCAGGAATCTTGTTAACAAGAAGGGACTTCTTCAATCAGATCAGGTTCTTTTCAGTGGTGGTGCTACGGAC
AGCATTGTCAATCAGTACGTCAGGGACTCTTCAATCTTCAGGTCTGATTTTGCAGCTGCCATGGTAAAGATGGGAGATTTAAGCCCCTTGACTGGTTCTCAAGGAGAGATAAGAAAAGTT
TGCAATGTTGTCAAC

Retrieve as FASTA