Entry information : MePrx31 (cassava4.1_011945m)
Entry ID 9110
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: MePrx31 (cassava4.1_011945m)
Name (synonym) MePrx31 (cassava4.1_011945m)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx31
start..stop
S start..stop
RcPrx54 589 0 1..321 1..324
PalPrx08 543 0 1..321 1..324
PtPrx75 533 0 18..321 1..306
GhPrx06 529 0 5..321 10..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 155724..156110 387 N° 2 156257..156419 163 N° 3 156787..157199 413  
join(155724..156110,156257..156419,156787..157199)


exon

Literature and cross-references MePrx31 (cassava4.1_011945m)
DNA ref. Phytozome 11:   scaffold03400 (155724..157199)
Protein sequence: MePrx31 (cassava4.1_011945m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (300)
PWM (Da):   %s   34412.45 (32160.3)  
PI (pH):   %s   8.33 (8.41) Peptide Signal:   %s   cut: 22 range:22-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGMQLLAFLLLTCMVATMVQGQGTRVGFYSSSCPRVESIVRTTVETHFRSNPTIAPGLLRMHFHDCFVHGCDASILIDGANSEKTAGPNLPLRGFEVIDDAKSKLEAACPGVVSCADILALAARDSVVLTRGPTWPVPTGRRDGRVSLASDTANLPGFTDSIDVQKQKFAALGLNTQDLVTLVGGHTIGATACQFFRYRLYNFSGNGADPSIDPAFVPQLQALCPQNGDASKRIALDTGSSNTFDSTFFSNLRNGRGILESDQKLWTDATTRTFVQRFLGIRGLLGLTFNVEFARSMVKMSNIGVKTGSNGEIRKICTAI

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCATGCAATTATTAGCATTTCTTCTCTTGACCTGCATGGTGGCCACCATGGTTCAAGGGCAAGGAACTCGAGTTGGCTTTTATTCGAGCTCATGTCCTCGGGTTGAATCCATAGTT
AGGACAACAGTTGAAACCCATTTCAGGTCTAATCCCACAATTGCACCTGGTTTGCTGAGGATGCACTTCCATGATTGCTTCGTGCATGGCTGTGATGCTTCCATTCTCATTGACGGAGCT
AACTCAGAGAAAACTGCAGGACCTAACCTTCCTCTCAGAGGATTTGAAGTCATTGACGACGCTAAGTCTAAACTCGAAGCTGCTTGCCCTGGAGTTGTCTCTTGTGCTGATATTTTAGCA
CTTGCCGCCCGCGACTCTGTGGTTTTG
GTATATATATTTACTATTTTTTCCAACTCGCTTTATTTATATTCTATTATTAGTTATTAAAAAGAGAAAATTACAAAGATATTTGATGTTACA
TATTTGTTTATTTATGAGTTTAACACGTGTGATATATATTTATGGATATTCAGACAAGAGGACCGACTTGGCCAGTACCCACAGGACGTAGAGATGGGAGGGTTTCTTTAGCATCCGATA
CTGCAAATTTGCCTGGCTTCACAGACTCCATTGATGTTCAAAAGCAAAAGTTTGCAGCTTTGGGTCTTAACACTCAAGATCTCGTTACCCTTGTTG
GTAAGATAATTATAAAGCTTTCAA
AAAGTCCACAGGTTTTGAAGTCATCAATTATGAGAATCCGCCTTTATTTTGATGATCCGACATGTTGATTTAGTGCAGTGGACCAATGACAAAAGATGTCAAGTCTCATATTATTTAACC
ATACTGTTTTTCCGACAAAACAAACAACTAGTTTGAAAAATTGAAAAGCAAAAATACGTAAAGTGGGATTATTTTATTTACAGTCAGCTCAAGGACAAAAATTTTTTTTCCTGATACCTG
TTTGAAATTAGTTAATTATTATAATTATCAATCTATAAAAATCAATTTTCTAATAATTTGGTTCAGCATTAATTTAACCTGAATAAGTTGCGTTGATTAACAGGAGGACACACGATAGGA
GCCACAGCCTGCCAATTCTTCAGATACAGGCTGTATAATTTCAGTGGAAATGGTGCAGATCCTTCCATCGACCCAGCATTTGTTCCACAACTACAGGCACTTTGTCCACAAAATGGTGAC
GCCTCCAAAAGAATTGCACTTGACACTGGCAGTTCCAACACTTTCGACTCAACTTTCTTCTCCAATTTGAGGAATGGCAGAGGAATTCTTGAATCTGATCAGAAGTTGTGGACTGATGCC
ACAACCAGAACCTTCGTTCAACGTTTCTTAGGCATCAGAGGCTTGCTTGGCTTGACCTTTAATGTGGAGTTCGCTAGATCCATGGTTAAAATGAGCAATATCGGTGTTAAAACTGGTTCA
AATGGCGAAATTCGTAAAATCTGTACTGCCATAAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCATGCAATTATTAGCATTTCTTCTCTTGACCTGCATGGTGGCCACCATGGTTCAAGGGCAAGGAACTCGAGTTGGCTTTTATTCGAGCTCATGTCCTCGGGTTGAATCCATAGTT
AGGACAACAGTTGAAACCCATTTCAGGTCTAATCCCACAATTGCACCTGGTTTGCTGAGGATGCACTTCCATGATTGCTTCGTGCATGGCTGTGATGCTTCCATTCTCATTGACGGAGCT
AACTCAGAGAAAACTGCAGGACCTAACCTTCCTCTCAGAGGATTTGAAGTCATTGACGACGCTAAGTCTAAACTCGAAGCTGCTTGCCCTGGAGTTGTCTCTTGTGCTGATATTTTAGCA
CTTGCCGCCCGCGACTCTGTGGTTTTG
ACAAGAGGACCGACTTGGCCAGTACCCACAGGACGTAGAGATGGGAGGGTTTCTTTAGCATCCGATACTGCAAATTTGCCTGGCTTCACAGAC
TCCATTGATGTTCAAAAGCAAAAGTTTGCAGCTTTGGGTCTTAACACTCAAGATCTCGTTACCCTTGTTG
GAGGACACACGATAGGAGCCACAGCCTGCCAATTCTTCAGATACAGGCTG
TATAATTTCAGTGGAAATGGTGCAGATCCTTCCATCGACCCAGCATTTGTTCCACAACTACAGGCACTTTGTCCACAAAATGGTGACGCCTCCAAAAGAATTGCACTTGACACTGGCAGT
TCCAACACTTTCGACTCAACTTTCTTCTCCAATTTGAGGAATGGCAGAGGAATTCTTGAATCTGATCAGAAGTTGTGGACTGATGCCACAACCAGAACCTTCGTTCAACGTTTCTTAGGC
ATCAGAGGCTTGCTTGGCTTGACCTTTAATGTGGAGTTCGCTAGATCCATGGTTAAAATGAGCAATATCGGTGTTAAAACTGGTTCAAATGGCGAAATTCGTAAAATCTGTACTGCCATA
AAT

Retrieve as FASTA