Entry information : MePrx62 (cassava4.1_021987m)
Entry ID 9120
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: MePrx62 (cassava4.1_021987m)
Name (synonym) MePrx62 (cassava4.1_021987m)
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx62
start..stop
S start..stop
PtPrx17 560 0 1..335 1..337
RcPrx48 555 0 5..335 6..337
GhPrx37 508 0 5..335 8..330
CclPrx118 505 0 7..335 9..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3420985..3421230 246 N° 2 3421390..3421581 192 N° 3 3421701..3421866 166 N° 4 3421987..3422387 401
join(3420985..3421230,3421390..3421581,3421701..3421866,3421987..3422387)


exon

Literature and cross-references MePrx62 (cassava4.1_021987m)
DNA ref. Phytozome 12:   scaffold01551 (3420985..3422387)
Protein sequence: MePrx62 (cassava4.1_021987m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (316)
PWM (Da):   %s   35927.66 (33801.5)  
PI (pH):   %s   4.19 (4.10) Peptide Signal:   %s   cut: 20 range:20-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATRLAFCFVMLKIVIAFAETPSTLNETCAGDIGFVLQFNIYQESCPEAEAIIFSWVETAISQDPRMAASLLRLHFHDCFVNGCDASVLLDDSGNFVGEKTAPPNLNSLRGFEVIDGIKAELESVCPQTVSCADILAIAARDSVVLSGGPSWEVHMGRKDSLSASKSAATNNIPAPNSTVATLVTSFQNVGLSLDDMVALSGAHTIGKARCTTFSSRLQGTANSNGHDINLDFIQSLQQLCSEPDSTSILAHLDLATPATFDNQYYLNLLLGEGLLPSDQTLVTDDDQTRLIVESYAEDPFLFFEDFKNSMLKMGSLGPLTEASGEIRTNCRAV

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACACGTTTAGCTTTCTGTTTTGTAATGCTTAAGATTGTAATTGCATTTGCAGAGACACCATCCACCTTGAATGAAACATGCGCAGGGGACATTGGCTTTGTTCTGCAATTTAAC
ATTTACCAAGAAAGCTGCCCGGAGGCTGAAGCTATCATCTTCTCTTGGGTTGAAACTGCAATCTCTCAGGACCCAAGAATGGCAGCTTCCCTACTTCGTCTTCATTTCCATGATTGCTTT
GTTAAT
GCAAGTCATGCTTTTCTATATGCTTTCTTTTCTTCACTCTCTCTCTCTCTCTATATATATATATATACACACACACAAGCACACCCACACATGGAGAGAGAAACAGCATTTCAG
CTGTGGTTATAACGGAAACTGATTAAACGTGGATGAGCTCTGCAGGGTTGTGACGCTTCAGTTTTGCTGGATGATAGTGGAAATTTTGTGGGTGAAAAAACAGCACCACCCAACTTGAAT
TCGTTGAGAGGATTTGAAGTCATCGATGGAATTAAAGCAGAACTAGAATCTGTTTGTCCTCAAACAGTGTCTTGTGCTGATATTCTTGCCATTGCAGCTAGAGATTCTGTCGTTCTG
GTA
TATACACCACGCACACATTTGCAGTTTAACTGCTCCCTCAAAGAACAAATTATGAATATTTTCCTACTGGTTTCTTTTAATGATTTGAGCTAATCTAAGAACTAAATCATTTTCAGTCAG
GAGGACCGAGTTGGGAGGTCCACATGGGTAGGAAGGACAGCTTGAGTGCTAGCAAATCAGCAGCCACAAACAATATTCCAGCTCCAAATTCTACTGTGGCTACCCTAGTGACCAGCTTTC
AGAATGTTGGCCTCTCACTCGATGACATGGTTGCCCTCTCTG
GTATTCTTATATCAAACATTCTTCATTTCACCTCATTGATGCCTTCGACNNNNNNNNNNNNNNNNNNNNNNCCAGCTT
GGCTTTAGTTGAACAGGTGTCTGACGATTCGTTATGCTGCAGGTGCTCATACCATAGGAAAAGCTAGATGCACAACCTTCAGCTCTCGGCTTCAAGGGACTGCCAACTCCAATGGCCATG
ATATTAATTTGGATTTCATTCAATCGCTGCAGCAGCTGTGTTCAGAACCTGACAGCACCTCAATTCTAGCACACCTGGACTTGGCGACTCCAGCGACATTTGACAACCAGTACTACCTTA
ATCTACTTTTGGGCGAGGGTTTACTTCCGTCCGACCAGACCCTTGTGACCGATGATGACCAAACACGCCTGATAGTAGAATCCTACGCAGAGGACCCCTTTTTGTTCTTTGAGGATTTCA
AGAATTCAATGTTAAAAATGGGAAGCTTGGGGCCACTGACTGAGGCTTCTGGGGAGATCCGCACCAACTGTAGGGCTGTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACACGTTTAGCTTTCTGTTTTGTAATGCTTAAGATTGTAATTGCATTTGCAGAGACACCATCCACCTTGAATGAAACATGCGCAGGGGACATTGGCTTTGTTCTGCAATTTAAC
ATTTACCAAGAAAGCTGCCCGGAGGCTGAAGCTATCATCTTCTCTTGGGTTGAAACTGCAATCTCTCAGGACCCAAGAATGGCAGCTTCCCTACTTCGTCTTCATTTCCATGATTGCTTT
GTTAAT
GGTTGTGACGCTTCAGTTTTGCTGGATGATAGTGGAAATTTTGTGGGTGAAAAAACAGCACCACCCAACTTGAATTCGTTGAGAGGATTTGAAGTCATCGATGGAATTAAAGCA
GAACTAGAATCTGTTTGTCCTCAAACAGTGTCTTGTGCTGATATTCTTGCCATTGCAGCTAGAGATTCTGTCGTTCTG
TCAGGAGGACCGAGTTGGGAGGTCCACATGGGTAGGAAGGAC
AGCTTGAGTGCTAGCAAATCAGCAGCCACAAACAATATTCCAGCTCCAAATTCTACTGTGGCTACCCTAGTGACCAGCTTTCAGAATGTTGGCCTCTCACTCGATGACATGGTTGCCCTC
TCTG
GTGCTCATACCATAGGAAAAGCTAGATGCACAACCTTCAGCTCTCGGCTTCAAGGGACTGCCAACTCCAATGGCCATGATATTAATTTGGATTTCATTCAATCGCTGCAGCAGCTG
TGTTCAGAACCTGACAGCACCTCAATTCTAGCACACCTGGACTTGGCGACTCCAGCGACATTTGACAACCAGTACTACCTTAATCTACTTTTGGGCGAGGGTTTACTTCCGTCCGACCAG
ACCCTTGTGACCGATGATGACCAAACACGCCTGATAGTAGAATCCTACGCAGAGGACCCCTTTTTGTTCTTTGAGGATTTCAAGAATTCAATGTTAAAAATGGGAAGCTTGGGGCCACTG
ACTGAGGCTTCTGGGGAGATCCGCACCAACTGTAGGGCTGTTAAT

Retrieve as FASTA