Entry information : MePrx64 (cassava4.1_022283m)
Entry ID 9122
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: MePrx64 (cassava4.1_022283m)
Name (synonym) MePrx64 (cassava4.1_022283m)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx64
start..stop
S start..stop
RcPrx76 556 0 1..324 1..330
PtPrx82 551 0 4..324 2..323
VvPrx65 549 0 1..324 1..323
PtPrx21 531 0 18..324 19..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 536086..536292 207 N° 2 534916..535107 192 N° 3 534255..534827 573  
complement(join(534255..534827,534916..535107,536086..536292))


exon

Literature and cross-references MePrx64 (cassava4.1_022283m)
DNA ref. Phytozome 11:   scaffold00325 (536292..534255)
Protein sequence: MePrx64 (cassava4.1_022283m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (302)
PWM (Da):   %s   34543.23 (32038.0)  
PI (pH):   %s   4.96 (4.92) Peptide Signal:   %s   cut: 23 range:23-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEARRGLFLLMILMMITNNGEAQLTENFYSSSCPAVEAIVKQAVSTKFSQTFTTIPATLRLFFHDCFVTGCDASIMVSSPNGDAEKDASDNLSLAGDGFDTVIKAKAAVEAQCPNVVSCADILAIAARDVVVLAGGPSFSVELGRRDGLISKSSLVSGNLPEPDFTLSKLNAIFAKNNLSQIDMIALSGAHTLGFSHCNRFANRIYSFSPSSPVDPSLDPDYAKQLMAACPRNVDPVIAIDMDPTTPRTFDNVYYQNLVAGKGLFTSDEVLFTDPASKPMVVDFANSPGDFNGAFVTAMRKLGRVGVKTGSQGRIRTDCTILNS

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCAAGAAGAGGATTGTTCTTGCTGATGATTTTAATGATGATTACAAACAATGGAGAAGCACAACTGACAGAGAACTTCTACAGCTCAAGCTGTCCGGCAGTGGAAGCTATAGTG
AAGCAGGCGGTGAGCACAAAGTTCAGCCAGACGTTCACTACAATTCCGGCAACTCTTCGTCTGTTCTTTCACGACTGCTTCGTTACT
GTAAGCATTAAGCCGCTTATATATTTTTATACG
ACATAACATGTTTTGATTGATTGGAAATATACACTTAGAATTTTCCTTTTTAACACATACCATCTGCATGAGTTTTTTATCATTAAAAAAGCAAGAAGAACAAAAATTCATTGGTGGTTT
TTGCAGAAATTGATGTGTGGTTTTGGGTTGGAATTGGAATGGTCATTCTTGGAGGGCTCAGTAGGGGATGATCATAATTTAGGTATAGTTTTGAGTTTGAATGTCGTTGCGTGTCCCAGT
TTCCAATTACCTAATCGTATTAAAAACATAATTTTCAATTCAAAGTTGGTTAGTTTTACAAATTTAGAAATGTGAACCACACGAATTAAAATTAGTTTTGGTAACACAAATGGAAATCCT
TCTTTATTAATTTTGCATAAAAGACTAAAAATTTTTAATTTGTTAAATATCGTAGAAAAGTCTATGATATCCGGGGGATGGAAACTGAAAAATGAGCTAATAATTTTTTTACTGCTATAA
AAATTAAATGGTAAAAACTAAAATTAAAGAAATTTATAATTTGACCAATTAATGAATTTTTTTATACTACAAGGACTAATAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCTATTAATTCTTAAAAACACACCAAAATTATGCTGAAATATACTTAGAAAATAGATATAATAATTAAACTGTATGACG
TAATCAAAAGTTGAGAAATATTTTATTGAGTTTTTCTTTGTTAACGACCACAATTCATCATAATTGTAAATCACCCAAAATTTTTATTTTAAATGCATAATTTTGATGTGAAGAAGTGCA
ATTTCGAGATTTAGTACTTGATAAGCATAAGCCAACTGAATATAGAACAAATATAATCTGTAAGAATTGAAGCTAACCTTAATTTATGTTTGGCTTCTAATCAAGGGTTGTGATGCCTCA
ATTATGGTTTCATCACCAAATGGAGATGCAGAGAAAGATGCTTCAGACAATCTCTCTCTTGCAGGAGATGGCTTTGATACTGTCATAAAAGCGAAGGCAGCAGTTGAAGCACAATGTCCA
AATGTTGTCTCCTGTGCAGATATTTTAGCAATCGCTGCAAGAGATGTCGTCGTCCTG
GTAAGTAAACCTATCAGAAAATTCTTACCTAAACTCGATCCACGTTACTAATACTCATGTTTT
ATTGTTTGATGTGACAAAAACTCAGGCCGGAGGTCCATCATTCAGCGTAGAGTTAGGGAGAAGAGATGGCTTAATTTCTAAATCATCACTTGTGTCTGGAAATCTACCTGAACCTGACTT
CACTCTTTCTAAACTCAACGCCATTTTTGCTAAAAACAACCTTAGCCAAATCGACATGATTGCACTCTCAGGAGCACACACATTAGGATTCTCTCACTGCAACCGTTTTGCAAATCGTAT
CTATTCATTCTCTCCATCTTCTCCTGTTGATCCTTCTCTGGATCCTGACTACGCCAAGCAGCTCATGGCTGCCTGTCCTCGCAATGTTGACCCTGTCATAGCCATAGACATGGACCCAAC
AACGCCACGAACATTTGACAATGTTTATTATCAGAATCTGGTTGCTGGTAAGGGCTTGTTTACTTCAGATGAGGTGCTGTTCACTGATCCTGCGTCTAAGCCTATGGTTGTTGATTTCGC
TAATAGCCCTGGCGATTTTAATGGAGCCTTTGTCACGGCTATGAGAAAACTTGGTAGAGTTGGAGTTAAGACTGGCAGCCAAGGTCGCATAAGGACAGATTGTACAATCCTTAATTCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCAAGAAGAGGATTGTTCTTGCTGATGATTTTAATGATGATTACAAACAATGGAGAAGCACAACTGACAGAGAACTTCTACAGCTCAAGCTGTCCGGCAGTGGAAGCTATAGTG
AAGCAGGCGGTGAGCACAAAGTTCAGCCAGACGTTCACTACAATTCCGGCAACTCTTCGTCTGTTCTTTCACGACTGCTTCGTTACT
GGTTGTGATGCCTCAATTATGGTTTCATCACCA
AATGGAGATGCAGAGAAAGATGCTTCAGACAATCTCTCTCTTGCAGGAGATGGCTTTGATACTGTCATAAAAGCGAAGGCAGCAGTTGAAGCACAATGTCCAAATGTTGTCTCCTGTGCA
GATATTTTAGCAATCGCTGCAAGAGATGTCGTCGTCCTG
GCCGGAGGTCCATCATTCAGCGTAGAGTTAGGGAGAAGAGATGGCTTAATTTCTAAATCATCACTTGTGTCTGGAAATCTA
CCTGAACCTGACTTCACTCTTTCTAAACTCAACGCCATTTTTGCTAAAAACAACCTTAGCCAAATCGACATGATTGCACTCTCAGGAGCACACACATTAGGATTCTCTCACTGCAACCGT
TTTGCAAATCGTATCTATTCATTCTCTCCATCTTCTCCTGTTGATCCTTCTCTGGATCCTGACTACGCCAAGCAGCTCATGGCTGCCTGTCCTCGCAATGTTGACCCTGTCATAGCCATA
GACATGGACCCAACAACGCCACGAACATTTGACAATGTTTATTATCAGAATCTGGTTGCTGGTAAGGGCTTGTTTACTTCAGATGAGGTGCTGTTCACTGATCCTGCGTCTAAGCCTATG
GTTGTTGATTTCGCTAATAGCCCTGGCGATTTTAATGGAGCCTTTGTCACGGCTATGAGAAAACTTGGTAGAGTTGGAGTTAAGACTGGCAGCCAAGGTCGCATAAGGACAGATTGTACA
ATCCTTAATTCT

Retrieve as FASTA