Entry information : MePrx66 ( cassava4.1_022712m)
Entry ID 9123
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-24 (Christophe Dunand)
Peroxidase information: MePrx66 ( cassava4.1_022712m)
Name (synonym) MePrx66 ( cassava4.1_022712m)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx66
start..stop
S start..stop
MePrx73 637 0 1..323 1..323
MePrx130 632 0 1..322 1..322
RcPrx88 537 0 1..323 1..322
RcPrx18 532 0 1..323 1..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1661301..1661507 207 N° 2 1660969..1661160 192 N° 3 1660725..1660890 166 N° 4 1660229..1660632 404
complement(join(1660229..1660632,1660725..1660890,1660969..1661160,1661301..1661 507))


exon

Literature and cross-references MePrx66 ( cassava4.1_022712m)
DNA ref. Phytozome 12:   scaffold11998 (1661507..1660229)
Protein sequence: MePrx66 ( cassava4.1_022712m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (302)
PWM (Da):   %s   35087.72 (32801.6) Transmb domain:   %s   i5-24o
PI (pH):   %s   7.34 (7.06) Peptide Signal:   %s   cut: 22 range:22-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTPFLFVCVIVLCVTGFCQGGALRKKFYKTSCPQAEDIVRRVTWSHVLSNPNLPAKLLRMHFHDCFVRGCDGSILLNSTATSTAEKDAIPNLTLSGFDTIDAIKSELENACPGVVSCADILALAARDSVSFQFQKPMWEVLTGRRDGNVSLASDVFSNLPSPFFDFSTLLKNFKNKGLNVHDLVVLSGGHTIGVGHCNLFSNRLYNFTGKGDQDPSLNSTYATFLKTKCQSLSDATTTVELDPGSSLNFDSNYFVILKENKGLFQSDAALITDKIARNIAGELVDSGTFFVEFAQSMKRLGAVQVLTGTEGEIRNKCSVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACCCCTTTTCTCTTTGTCTGTGTGATTGTTTTGTGTGTGACTGGGTTTTGTCAAGGAGGTGCTTTGAGGAAGAAATTCTACAAGACATCCTGTCCTCAAGCAGAGGATATTGTC
AGAAGGGTCACCTGGAGCCATGTCTTAAGCAACCCCAACTTGCCTGCAAAGCTTTTGAGAATGCATTTTCATGACTGTTTTGTTAGG
GTAAGACTCATGCATGCATGCTTATGTTAGTCT
AAATATATAGTCTTACACTTGAAGATAAGACACTCCCTGAAAGTTTTCTTGTTGTCCAAAAAGAAAGAATTCATGACTAACTCACACATTTGGAAATTGAATTTCAGGGCTGCGACGGCT
CTATTTTACTAAATTCCACTGCTACTAGCACTGCGGAGAAAGATGCAATTCCAAATCTAACTTTATCAGGATTTGATACTATTGATGCCATAAAATCAGAGTTAGAGAATGCATGTCCAG
GAGTTGTATCTTGTGCTGACATCTTGGCCTTGGCCGCGAGGGACTCAGTTTCCTTCCAA
GTATAAGTTGAAAATGAAACCGTTATACAAATTCTTGCATGTCTCATATAACTAATGCATC
TATTGCTTCTCGTGCAGTTCCAAAAACCCATGTGGGAAGTGCTTACTGGTAGGAGAGACGGCAACGTTTCATTAGCTTCCGATGTCTTTTCTAACCTTCCTTCGCCCTTCTTCGACTTCT
CCACTCTATTGAAAAATTTCAAGAACAAGGGTCTCAACGTCCATGATCTAGTTGTACTATCAG
GTACATAATATATATTGTCGGTCCCAGGAAATTACTTAGAAAATGATGACATATGTG
TATCAGGGACTAATAAATGCACTTGAATTATGTAGGCGGACACACCATTGGAGTAGGCCACTGTAATCTCTTCAGTAACAGACTCTACAACTTCACAGGCAAAGGCGACCAGGACCCTTC
TCTGAACTCCACATACGCAACTTTCTTGAAGACCAAATGCCAAAGTCTCAGTGACGCGACCACCACCGTAGAGTTGGATCCTGGAAGCTCTCTAAACTTCGATAGCAATTACTTCGTTAT
CCTCAAGGAGAACAAGGGTTTATTCCAATCCGACGCAGCCCTTATAACGGACAAGATCGCAAGAAACATTGCTGGAGAGTTGGTTGATTCGGGAACTTTCTTCGTTGAGTTTGCACAGTC
AATGAAAAGGTTGGGAGCAGTTCAAGTTCTTACTGGCACTGAAGGGGAGATCAGGAACAAGTGCAGTGTAGTCAATGCC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACCCCTTTTCTCTTTGTCTGTGTGATTGTTTTGTGTGTGACTGGGTTTTGTCAAGGAGGTGCTTTGAGGAAGAAATTCTACAAGACATCCTGTCCTCAAGCAGAGGATATTGTC
AGAAGGGTCACCTGGAGCCATGTCTTAAGCAACCCCAACTTGCCTGCAAAGCTTTTGAGAATGCATTTTCATGACTGTTTTGTTAGG
GGCTGCGACGGCTCTATTTTACTAAATTCCACT
GCTACTAGCACTGCGGAGAAAGATGCAATTCCAAATCTAACTTTATCAGGATTTGATACTATTGATGCCATAAAATCAGAGTTAGAGAATGCATGTCCAGGAGTTGTATCTTGTGCTGAC
ATCTTGGCCTTGGCCGCGAGGGACTCAGTTTCCTTCCAA
TTCCAAAAACCCATGTGGGAAGTGCTTACTGGTAGGAGAGACGGCAACGTTTCATTAGCTTCCGATGTCTTTTCTAACCTT
CCTTCGCCCTTCTTCGACTTCTCCACTCTATTGAAAAATTTCAAGAACAAGGGTCTCAACGTCCATGATCTAGTTGTACTATCAG
GCGGACACACCATTGGAGTAGGCCACTGTAATCTC
TTCAGTAACAGACTCTACAACTTCACAGGCAAAGGCGACCAGGACCCTTCTCTGAACTCCACATACGCAACTTTCTTGAAGACCAAATGCCAAAGTCTCAGTGACGCGACCACCACCGTA
GAGTTGGATCCTGGAAGCTCTCTAAACTTCGATAGCAATTACTTCGTTATCCTCAAGGAGAACAAGGGTTTATTCCAATCCGACGCAGCCCTTATAACGGACAAGATCGCAAGAAACATT
GCTGGAGAGTTGGTTGATTCGGGAACTTTCTTCGTTGAGTTTGCACAGTCAATGAAAAGGTTGGGAGCAGTTCAAGTTCTTACTGGCACTGAAGGGGAGATCAGGAACAAGTGCAGTGTA
GTCAATGCC

Retrieve as FASTA