Entry information : MePrx88 ( cassava4.1_026031m)
Entry ID 9143
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-19 (Christophe Dunand)
Peroxidase information: MePrx88 ( cassava4.1_026031m)
Name (synonym) MePrx88 ( cassava4.1_026031m)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx88
start..stop
S start..stop
MePrx127 587 0 2..319 7..324
LePrx91 522 0 2..319 8..324
CsPrx46 517 0 2..319 7..323
CclPrx83 516 0 2..319 7..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2231307..2231504 198 N° 2 2231034..2231225 192 N° 3 2230748..2230913 166 N° 4 2230248..2230651 404
complement(join(2230248..2230651,2230748..2230913,2231034..2231225,2231307..2231 504))


exon

Literature and cross-references MePrx88 ( cassava4.1_026031m)
DNA ref. Phytozome 11:   scaffold01551 (2231504..2230248)
Protein sequence: MePrx88 ( cassava4.1_026031m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (302)
PWM (Da):   %s   35090.86 (33127.8)  
PI (pH):   %s   8.14 (8.21) Peptide Signal:   %s   cut: 19 range:19-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
FFFLITIALAYAIGVCYGGELRKDFYKDTCPEAEDIVKSIIWKRVASNSTLPAKFLRMHFHDCFVRGCDASVLLDSTTNNTAEKAAIPNLSLGGFEVIDEVKAQLEKKCPGVVSCADIVALAARDSVSFQFKKPIWEVLTGRRDGSISRASEALSNIPSPFFNFTLLKQSFANKSLTVHDLVVLSGGHTIGVGHCNFFSNRLYNFTGKGDADPSLNSTYASFLKTQCRSLADNTTIVPMDPSTPLSFDNNYYKILKLKEGLFQSDAALLTDKGSRNIVDELLDSGKFFTEFSQSMKRMGSIQVLTGTAGEIRKNCRVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCTTCTTCTTGATAACCATTGCATTAGCTTATGCAATAGGAGTTTGCTATGGAGGGGAACTGAGGAAAGACTTCTACAAAGATACTTGTCCAGAGGCTGAGGACATTGTGAAGAGTATC
ATTTGGAAGCGTGTTGCAAGCAATTCAACATTGCCTGCCAAGTTTCTAAGGATGCATTTCCACGACTGTTTTGTTAGG
GTAACTTTTCTCCATCTATTCCATATACTATATATTTCTTTT
CAACACACATATGTATATTATTTTGTCCTCTTCGGGCAGGGCTGTGATGCCTCTGTGTTGCTGGATTCCACGACAAATAACACTGCGGAAAAGGCAGCAATTCCAAATCTATCTCTAGGA
GGCTTTGAAGTGATAGATGAGGTTAAGGCCCAGCTAGAGAAGAAATGCCCTGGAGTGGTTTCTTGTGCCGATATTGTTGCTCTAGCCGCTAGAGACTCTGTTTCCTTCCAA
GTATATGTG
AACATTAATTTCAGGAATTATTGTCACTATTAATTAATTGGTTTCCTTGGCCCTAATAACTAATGGACTTCATTTTTTTTGTATGTCTGTTGCTGTGGTTAATGAGCTCAGTTTAAAAAG
CCAATTTGGGAGGTGCTTACTGGTAGAAGAGATGGATCAATTTCTCGAGCATCAGAGGCTCTCTCCAACATCCCTTCACCTTTCTTCAACTTCACCCTTCTCAAACAGTCTTTTGCTAAC
AAAAGCCTAACAGTTCATGACCTTGTCGTCTTATCTG
GTAAATTTTTTAATGCTTTAATCATTTTACCACCCATGCATTTCCTTTATTGGTCAAAAAATTGACATTAGATGTATATTCAT
TACGTTTGGTAAGGTGGACACACCATTGGGGTAGGACACTGCAACTTCTTCAGCAACAGGCTATACAACTTCACAGGAAAAGGTGACGCAGACCCTTCTCTGAACTCAACCTATGCTTCT
TTCTTGAAGACCCAATGCCGAAGCCTCGCAGATAACACAACAATAGTTCCAATGGACCCCTCCACCCCCTTATCTTTCGACAACAATTACTACAAAATTCTCAAGCTGAAGGAAGGCCTT
TTCCAATCTGATGCTGCACTTCTCACTGACAAGGGCTCTAGAAATATCGTCGACGAATTGCTGGACTCTGGAAAGTTCTTCACTGAATTTTCACAATCCATGAAGAGGATGGGATCCATC
CAAGTGCTTACTGGAACTGCTGGAGAAATCAGGAAGAACTGTAGGGTGGTGAATTCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCTTCTTCTTGATAACCATTGCATTAGCTTATGCAATAGGAGTTTGCTATGGAGGGGAACTGAGGAAAGACTTCTACAAAGATACTTGTCCAGAGGCTGAGGACATTGTGAAGAGTATC
ATTTGGAAGCGTGTTGCAAGCAATTCAACATTGCCTGCCAAGTTTCTAAGGATGCATTTCCACGACTGTTTTGTTAGG
GGCTGTGATGCCTCTGTGTTGCTGGATTCCACGACAAATAAC
ACTGCGGAAAAGGCAGCAATTCCAAATCTATCTCTAGGAGGCTTTGAAGTGATAGATGAGGTTAAGGCCCAGCTAGAGAAGAAATGCCCTGGAGTGGTTTCTTGTGCCGATATTGTTGCT
CTAGCCGCTAGAGACTCTGTTTCCTTCCAA
TTTAAAAAGCCAATTTGGGAGGTGCTTACTGGTAGAAGAGATGGATCAATTTCTCGAGCATCAGAGGCTCTCTCCAACATCCCTTCACCT
TTCTTCAACTTCACCCTTCTCAAACAGTCTTTTGCTAACAAAAGCCTAACAGTTCATGACCTTGTCGTCTTATCTG
GTGGACACACCATTGGGGTAGGACACTGCAACTTCTTCAGCAAC
AGGCTATACAACTTCACAGGAAAAGGTGACGCAGACCCTTCTCTGAACTCAACCTATGCTTCTTTCTTGAAGACCCAATGCCGAAGCCTCGCAGATAACACAACAATAGTTCCAATGGAC
CCCTCCACCCCCTTATCTTTCGACAACAATTACTACAAAATTCTCAAGCTGAAGGAAGGCCTTTTCCAATCTGATGCTGCACTTCTCACTGACAAGGGCTCTAGAAATATCGTCGACGAA
TTGCTGGACTCTGGAAAGTTCTTCACTGAATTTTCACAATCCATGAAGAGGATGGGATCCATCCAAGTGCTTACTGGAACTGCTGGAGAAATCAGGAAGAACTGTAGGGTGGTGAATTCT

Retrieve as FASTA