Entry information : MePrx93 (cassava4.1_026755m)
Entry ID 9147
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: MePrx93 (cassava4.1_026755m)
Name (synonym) MePrx93 (cassava4.1_026755m)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx93
start..stop
S start..stop
RcPrx70 553 0 4..328 5..327
PtPrx25 520 0 1..329 1..325
PtPrx27 514 0 1..329 1..327
MePrx24 506 0 1..329 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 50164..50376 213 N° 2 49847..50044 198 N° 3 49592..49754 163 N° 4 48428..48840 413
complement(join(48428..48840,49592..49754,49847..50044,50164..50376))


exon

Literature and cross-references MePrx93 (cassava4.1_026755m)
DNA ref. Phytozome 12:   scaffold02174 (50376..48428)
Protein sequence: MePrx93 (cassava4.1_026755m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (305)
PWM (Da):   %s   35823.13 (33262.8) Transmb domain:   %s   i3-22o
PI (pH):   %s   6.25 (6.25) Peptide Signal:   %s   cut: 25 range:25-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRVIGYFGLIIFGVLAFMGSSTEAQLQMGFYAKSCPKAEKIVQDFVNKHIHNAPSLAASFLRLNFHDCFVRGCDASVLLNSSSSSGEQPEKEAIPNQTIRGFDFLDRVKSLLEDKCPGIVSCADILALVARDSIVATGGPFWRVPTGRRDGVISRLSEAMADIPPPFANFSTLQTQFADKGLDLKDLVLLSGAHTIGISHCPAFSDRLYNFSGTGEPDPSLDSEYAANLRANKCRTPDDRTTIVEMDPGSRKTFDLSYYSLLLKRRGLFESDAVLITDPVTLSLINQLLSGSVDDFFAQFANSMEKLGRVDVKTGTDGQIRKHCAVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (Exon 1 is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGTGATAGGTTATTTTGGTTTAATAATATTTGGTGTTTTAGCATTTATGGGTTCATCAACTGAAGCTCAATTGCAAATGGGTTTTTATGCTAAGAGCTGCCCAAAAGCTGAGAAG
ATTGTTCAAGATTTTGTCAACAAACACATCCATAATGCTCCATCTTTAGCTGCTTCTTTCTTGAGATTGAACTTCCATGATTGCTTCGTCAGG
GTTTGTCTCTTTGATCATTTCTTAATT
AATTAAGCTGGATCACTCGCTGCTTGTTTTTTTTTTTTTTCATTTTGAGATTTGAACTCGAAACCTCATTTATGATATGTTCTTGGCATCAGGGTTGTGATGCATCTGTGCTTCTGAACT
CGTCATCGAGCTCTGGCGAACAACCTGAAAAGGAAGCTATTCCAAATCAAACAATAAGAGGATTTGACTTCCTAGACAGAGTGAAGAGCCTTCTTGAAGATAAATGTCCTGGCATAGTAT
CCTGTGCAGACATTCTTGCTTTGGTCGCAAGGGATTCCATTGTGGCTACA
GTATGTAATTAAATCAATGGACATTAAAGAAAAATCTTGAATTATAACATGTTCCCAAATGATTAATGTT
GTTGTTGTTGATTTGGATACAGGGAGGTCCCTTTTGGAGAGTTCCAACTGGAAGAAGAGATGGTGTAATATCAAGGTTGTCTGAGGCCATGGCCGACATCCCACCTCCCTTTGCAAACTT
CTCTACTCTTCAGACTCAATTTGCCGACAAAGGTCTTGATTTGAAAGACCTGGTTTTGCTTTCCG
GTAATTATGCAATATCCTCACATATAAATAAGGTCTTAAATTAAACAGCTTTCTT
TTACATAGTTTGTGNNNNNNNNNNNNNNNNNNNNNCTGCAATTTCAACGTCAGATTTGCTTTTCTTATCATGTATAGAAAATTTTACCTAAATCAGNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNCATGTGAATCTTACTTTCATTTTACATAACGGGCCTACATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTACCTCAATATAAATTCTCAGTGCGAGCAATTATTATATAAAATTTTCTTGAAAAAAA
GCATATATAATGTGGAATTCACATGGAGAAAAAAAAAAAAGCTAAATGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTCT
TTTAACTTTCAAATATTAAAAACTTATATAGCGAATGAGTAAATTTATATATGCTATTCAAAATTTAAAAAATTAAAACTGTAAATAAGATGAAGGATAAATTAGGAGGGTAAAATGATA
TTTTGTGAAAAGTTAAGGGGCAAATTATATATTTTCTATAATTTCCGCATATATAATACATTGANNNNNNNNNNNNNNNNNNNNNNNNTTGTGCAGGGGCTCACACAATTGGGATATCCC
ATTGTCCAGCATTTTCAGACCGTTTATACAACTTCAGTGGAACTGGTGAGCCAGATCCTAGCCTAGACAGTGAGTATGCTGCAAATCTAAGGGCAAATAAGTGCAGAACTCCTGATGATA
GAACCACCATTGTTGAGATGGATCCAGGAAGTAGAAAAACATTTGATCTTAGCTACTACTCTCTCTTGCTTAAAAGAAGAGGCCTTTTTGAATCAGACGCTGTTTTGATCACTGACCCTG
TTACTTTATCTCTCATCAACCAACTTCTCAGTGGTTCTGTTGATGATTTCTTTGCTCAGTTTGCCAATTCCATGGAGAAATTAGGCAGAGTTGATGTTAAAACTGGAACTGATGGTCAAA
TTAGAAAGCACTGTGCAGTTGTTAATAGT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGTGATAGGTTATTTTGGTTTAATAATATTTGGTGTTTTAGCATTTATGGGTTCATCAACTGAAGCTCAATTGCAAATGGGTTTTTATGCTAAGAGCTGCCCAAAAGCTGAGAAG
ATTGTTCAAGATTTTGTCAACAAACACATCCATAATGCTCCATCTTTAGCTGCTTCTTTCTTGAGATTGAACTTCCATGATTGCTTCGTCAGG
GGTTGTGATGCATCTGTGCTTCTGAAC
TCGTCATCGAGCTCTGGCGAACAACCTGAAAAGGAAGCTATTCCAAATCAAACAATAAGAGGATTTGACTTCCTAGACAGAGTGAAGAGCCTTCTTGAAGATAAATGTCCTGGCATAGTA
TCCTGTGCAGACATTCTTGCTTTGGTCGCAAGGGATTCCATTGTGGCTACA
GGAGGTCCCTTTTGGAGAGTTCCAACTGGAAGAAGAGATGGTGTAATATCAAGGTTGTCTGAGGCCATG
GCCGACATCCCACCTCCCTTTGCAAACTTCTCTACTCTTCAGACTCAATTTGCCGACAAAGGTCTTGATTTGAAAGACCTGGTTTTGCTTTCCG
GGGCTCACACAATTGGGATATCCCAT
TGTCCAGCATTTTCAGACCGTTTATACAACTTCAGTGGAACTGGTGAGCCAGATCCTAGCCTAGACAGTGAGTATGCTGCAAATCTAAGGGCAAATAAGTGCAGAACTCCTGATGATAGA
ACCACCATTGTTGAGATGGATCCAGGAAGTAGAAAAACATTTGATCTTAGCTACTACTCTCTCTTGCTTAAAAGAAGAGGCCTTTTTGAATCAGACGCTGTTTTGATCACTGACCCTGTT
ACTTTATCTCTCATCAACCAACTTCTCAGTGGTTCTGTTGATGATTTCTTTGCTCAGTTTGCCAATTCCATGGAGAAATTAGGCAGAGTTGATGTTAAAACTGGAACTGATGGTCAAATT
AGAAAGCACTGTGCAGTTGTTAATAGT

Retrieve as FASTA