Entry information : MePrx[P]61 (cassava4.1_021820m)
Entry ID 9155
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2012-01-05 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-12-01 (Qiang Li)
Peroxidase information: MePrx[P]61 (cassava4.1_021820m)
Name (synonym) MePrx[P]61 (cassava4.1_021820m)
Class Class III peroxidase     [Orthogroup: Prx007]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx[P]61
start..stop
S start..stop
MePrx09 327 2e-113 1..235 79..342
RcPrx47 292 2e-99 2..236 83..346
RcPrx11 286 3e-97 2..236 84..347
EcPrx01 280 1e-94 2..235 78..339
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 532116..532298 183 N° 2 531644..532040 397 N° 3 531473..531613 141  
complement(join(531473..531613,531644..532040,532116..532298))


exon

Literature and cross-references MePrx[P]61 (cassava4.1_021820m)
DNA ref. Phytozome 12:   scaffold07519 (532298..531473)
Protein sequence: MePrx[P]61 (cassava4.1_021820m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   240
PWM (Da):   %s   26070.18  
PI (pH):   %s   6.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
QGCDSSVLLDGSAGGPSEKSERPNLTLRKQALKSSTSFERLSTNSVAVSSLALT*SPSLPVLQTGLDYDVLLGRRDGVNFARVNQTFVDLVGPDANTTTILVKLARKKLDATDAVALSGSHTIGIGHTTSFTDRLYPTQDPTMDKTFAKSLKRTCPKPDTRNTTFLDIRSPNKFDNKYYxVDLMNRQGLFTSDHDSFHDQDGELNVLTGKQGEIRANCSARNSDNKLLVYVAEEEMDHLLK

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (5' is missing; stop in frame). complement(join(531473..531613,531644..532040,532116..532298))
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGGATGCGATAGCTCGGTGTTGCTTGATGGATCCGCCGGAGGACCAAGTGAAAAATCTGAACGGCCTAACTTAACCTTAAGAAAACAAGCTTTAAAATCGTCAACAAGCTTCGAGAGATT
GTCCACAAACAGTGTGGCCGTGTCGTCTCTTGCTCTGACATAGTCGCCATCGCTGCCCGTGAT
TCCGTTTTCTTGGTAATCACCAACTACTGTAACTTTTTCACTTCTTTAAAGATAACT
CAGTTTCTTTTATGGGTTGCAGACCGGTCTTGACTACGACGTCCTATTGGGAAGACGAGATGGAGTAAACTTCGCTCGAGTGAATCAAACTTTTGTAGACCTAGTAGGACCAGACGCTAA
CACTACCACCATTCTCGTCAAGCTTGCTCGGAAAAAGCTTGATGCCACCGATGCAGTGGCCCTATCAGGTTCCCACACCATCGGCATAGGCCACACCACATCCTTCACCGACCGTCTTTA
TCCAACCCAAGATCCTACCATGGACAAAACCTTCGCCAAAAGTCTCAAGCGAACTTGTCCGAAACCAGACACCAGGAACACAACTTTCTTGGATATTCGATCCCCTAATAAATTTGACAA
CAAGTACTACTNNGTTGATCTCATGAACCGCCAAGGGCTGTTTACCTCGGACCAT
TGTTACTAGCTTCGCCATTAATGAAACACTGATAGTTTCCATGATCAAGATGGGGAACTGAACGT
TTTGACAGGGAAACAAGGGGAAATTCGAGCCAATTGTTCTGCCAGGAACTCTGATAACAAGCTTTTGGTGTATGTAGCAGAAGAGGAGATGGATCACCTGCTGAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGGATGCGATAGCTCGGTGTTGCTTGATGGATCCGCCGGAGGACCAAGTGAAAAATCTGAACGGCCTAACTTAACCTTAAGAAAACAAGCTTTAAAATCGTCAACAAGCTTCGAGAGATT
GTCCACAAACAGTGTGGCCGTGTCGTCTCTTGCTCTGACATAGTCGCCATCGCTGCCCGTGAT
GCAGACCGGTCTTGACTACGACGTCCTATTGGGAAGACGAGATGGAGTAAACTTCGC
TCGAGTGAATCAAACTTTTGTAGACCTAGTAGGACCAGACGCTAACACTACCACCATTCTCGTCAAGCTTGCTCGGAAAAAGCTTGATGCCACCGATGCAGTGGCCCTATCAGGTTCCCA
CACCATCGGCATAGGCCACACCACATCCTTCACCGACCGTCTTTATCCAACCCAAGATCCTACCATGGACAAAACCTTCGCCAAAAGTCTCAAGCGAACTTGTCCGAAACCAGACACCAG
GAACACAACTTTCTTGGATATTCGATCCCCTAATAAATTTGACAACAAGTACTACTNNGTTGATCTCATGAACCGCCAAGGGCTGTTTACCTCGGACCAT
GATAGTTTCCATGATCAAGA
TGGGGAACTGAACGTTTTGACAGGGAAACAAGGGGAAATTCGAGCCAATTGTTCTGCCAGGAACTCTGATAACAAGCTTTTGGTGTATGTAGCAGAAGAGGAGATGGATCACCTGCTGAA
A

Retrieve as FASTA