Entry information : CclAPx04 (clementine0.9_019617m)
Entry ID 9160
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclAPx04 (clementine0.9_019617m)
Name (synonym) CclAPx04 (clementine0.9_019617m)
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclAPx04
start..stop
S start..stop
CsAPx01 516 0 1..250 1..250
PtriAPx01 508 0 1..250 1..250
InAPx01 462 5e-168 1..250 1..250
IbAPx01 455 4e-165 1..250 1..250
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2512919..2513037 119 N° 2 2513114..2513288 175 N° 3 2513399..2513464 66 N° 4 2514278..2514326 49
N° 5 2514411..2514496 86 N° 6 2514620..2514699 80 N° 7 2514843..2514945 103 N° 8 2515067..2515125 59
N° 9 2515245..2515260 16  
join(2512919..2513037,2513114..2513288,2513399..2513464,2514278..2514326,2514411 ..2514496,2514620..2514699,2514843..2514945,2515067..2515125,2515245..2515260)


exon

Literature and cross-references CclAPx04 (clementine0.9_019617m)
DNA ref. Phytozome 12:   scaffold_8 (2512919..2515260)
Protein sequence: CclAPx04 (clementine0.9_019617m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250
PWM (Da):   %s   27481.86  
PI (pH):   %s   5.91
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKYADEDAFFADYAEAHLKLSELGFAEA

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAGAATTACCCCACTGTTAGCGAGGATTACAAGAAGGCCGTGGAGAAATGCAAGAGGAAGCTCAGAGGCTTCATCGCTGAGAAGAACTGCGCTCCACTCATGCTCCGTATCGCG
TACGTGTACTCTCTCGTTATACGTATGTATTGAATATGTGTGGGTGTGAGATTGATTTTTTTTTTAATTGTTCAGGTGGCACTCAGCTGGTACATATGATGTGAAGACCAAGACCGGAGG
TCCATTCGGAACCATGAGGCTCGCTGCTGAGCAGGCACACTCAGCCAACAACGGCCTCGATATTGCCGTTAGGCTTTTGGAGCCGTTCAAGGAGCAGTTCCCTACCATCTCCTACGCTGA
CCTTTATCAG
GTACTGTATAAATCAATTTGTTAATATCAGACGGCGATCTTTGACTTTTCTGATGACCGATTTAAATTTGTTTAACCGATCTTTTTTGTTTATCATCGTGGATCATGTAG

CTTGCTGGTGTTGTTGGCGTTGAGGTTACCGGTGGGCCCGATATCCCCTTCCACCCGGGAAGAGAT
GTAAGTTATTATTATTCGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCT
GTTGTTTCGAGGATGAAATCGATTTGTGAAATTGATCTTAGTAGCTTGTTTAATTGTTTTGCTTGATTTATGTAAATTAATGTTGAAACATTTATAGCTCATTTACTGATAAAATTGGCC
TTATTTACTGNNNNNNNNNNNNNNNNNNNNNGTGAGTGTTACTCTGTTTTCTGGTCTTTGGCTTTCATTGTTCTGTGTAAAACTTTATTTGGTCGTTGGGTGAAAATTGAAATTAAAGGA
AGCAGTATAGGAATGTGCATGCGATACTTTTCTAGTTTTTTTTAGCGACTGCACTTGGCTTGGAAGATGTTGATGAATTTGTGGAAATTTTTAGAAATAAGAAAGTTGTTTCATAACATA
AAACTTGTGGCTTTTGAAATTGTGTTGCGCAATCAAATTGCTACGATTGTCTATGCGGACTACCACAAGTTTTGTGTGACTCTGTGGATGGCCCTCCGTGGTTAAGTGGCTGGGTAATGG
ATACTGAAGTTATTGCACTGTTGCTTTTTTCACTGTACTTTGGTTATCAAATAAAATATCAGCCACCCTTTTGATGTGACATTACACACGTCCAAGTTTACAACACTGTTTATTATAACA
TTGTATATTGAAATTATAACACTTAGCTAGTTTTTTTCCCCTTTTAGTTGTGATTTGCTCTATTTATCTATAAAATACTTATCTGTATGGTGTTTTTGATTACAAATCTTGTATTGTTGT
GATTTTTTGCTACTGACAATGGCCGTCTCCTATTCTCAGGACAAGGCTGAGCCACCTCAAGAAGGCCGGCTTCCTGATGCTAAACAGGGTTTGTATTTTTTTTAAGGATCTTATTAAATG
AGCTGTTTTGTTGCTTCATCTTGGATGGCTTCTTTACATTTAATTGCTGCAGGTAATGATCACTTGAGGCAAGTCTTTGGTGCTCAGATGGGCCTCAGCGACAAGGATATTGTTGCTCTC
TCTGGTGGCCACACCCTG
GTTAGTGCTAAACTGTGAAGATTTGTTGCTTTCCTCGTGTGCTGAAATAATGTGGTTGTGAAGTGTTAAATTGGCTGCATTGTTTATAGTCTAATCAGCTTA
TTGGTTTGAATAACTTTGTAGGGAAGGTGCCACAAGGAGAGGTCTGGATTTGAGGGACCATGGACCCGCAACCCTCTCATTTTTGACAATTCCTACTTCACGTATGTGTCACTGGTCTCT
TTGCCTGACATGTTCGGTTGTGTATTGTTTGAGTCTTTTTGCATGAATAGTAGTCTTACTTTAAAATGTTAAATGAGTCCGTAGTTTAGGGAGAAATTTGACCTTGAGTGTGCATGAAAA
ATAGGGAGCTCTTGACTGGTGAGAAGGATGGTCTTCTGCAATTGCCATCCGACAAGGCCCTTCTGGATGACCCTGTTTTCCGCCCTCTTGTTGAGAAATATGCTGCGGTGCGTATGCTTA
ATTTTTATACTTCCTCAATGGTATATTGTTATTCACTTTATGTTCTGTTGGTATTTTCAAATGAATGTACTCTGATGATTATTTTGGTTGCTTCTTATCACCTTTCAGGATGAGGACGCT
TTCTTCGCTGATTATGCTGAGGCTCATCTCAAGCTCTCTGAGCTAGG
GTAAGATTCTTTTCACCTTTGCTGATTATGCTTATTTCAATTTTATTGTTTTTCCCTCTCTTAAAAATCTTCC
TAATGTTACAACTCAACTTATTGGGTGCGCCTGTTCTTTGTTGCAGATTTGCTGAAGCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAGAATTACCCCACTGTTAGCGAGGATTACAAGAAGGCCGTGGAGAAATGCAAGAGGAAGCTCAGAGGCTTCATCGCTGAGAAGAACTGCGCTCCACTCATGCTCCGTATCGCG
TGGCACTCAGCTGGTACATATGATGTGAAGACCAAGACCGGAGGTCCATTCGGAACCATGAGGCTCGCTGCTGAGCAGGCACACTCAGCCAACAACGGCCTCGATATTGCCGTTAGGCTT
TTGGAGCCGTTCAAGGAGCAGTTCCCTACCATCTCCTACGCTGACCTTTATCAG
CTTGCTGGTGTTGTTGGCGTTGAGGTTACCGGTGGGCCCGATATCCCCTTCCACCCGGGAAGAGAT
GACAAGGCTGAGCCACCTCAAGAAGGCCGGCTTCCTGATGCTAAACAGGGTAATGATCACTTGAGGCAAGTCTTTGGTGCTCAGATGGGCCTCAGCGACAAGGATATTGTTGCTCTCTCT
GGTGGCCACACCCTG
GGAAGGTGCCACAAGGAGAGGTCTGGATTTGAGGGACCATGGACCCGCAACCCTCTCATTTTTGACAATTCCTACTTCACGGAGCTCTTGACTGGTGAGAAGGAT
GGTCTTCTGCAATTGCCATCCGACAAGGCCCTTCTGGATGACCCTGTTTTCCGCCCTCTTGTTGAGAAATATGCTGCG
GATGAGGACGCTTTCTTCGCTGATTATGCTGAGGCTCATCTC
AAGCTCTCTGAGCTAGG
ATTTGCTGAAGCCTAA

Retrieve as FASTA