Entry information : CclAPx05 (clementine0.9_019618m)
Entry ID 9161
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclAPx05 (clementine0.9_019618m)
Name (synonym) CclAPx05 (clementine0.9_019618m)
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclAPx05
start..stop
S start..stop
CsAPx02 511 0 1..250 1..250
PtriAPx02 509 0 1..250 1..250
CroAPx02 494 1e-180 1..250 1..250
PtAPx02 481 3e-175 1..249 1..249
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 730801..730919 119 N° 2 730475..730649 175 N° 3 730292..730357 66 N° 4 729683..729731 49
N° 5 729497..729579 83 N° 6 729282..729361 80 N° 7 729056..729158 103 N° 8 728904..728962 59
N° 9 728778..728796 19  
complement(join(728778..728796,728904..728962,729056..729158,729282..729361,7294 97..729579,729683..729731,730292..730357,730475..730649,730801..730919))


exon

Literature and cross-references CclAPx05 (clementine0.9_019618m)
DNA ref. Phytozome 12:   scaffold_101 (730919..728778)
Protein sequence: CclAPx05 (clementine0.9_019618m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   251
PWM (Da):   %s   27541  
PI (pH):   %s   5.99
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGKCYPKVSDEYQKAVEKCKRKLRGLIAEKHCAPIILRLAWHSAGTYDVNTKTGGPFGTIRHPDELAHEANNGLDIAVRLLEPIKQQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRPDKSDPPPEGRLPNATKGSDHLRDVFGHMGLSDKDIVVLSGGHTLGRCHKERSGFEGPWTNNPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFRPLVEKYAADEDAVFADYAEAHLKLSELGFADAE*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAAGTGTTATCCAAAAGTGAGCGATGAGTATCAGAAAGCAGTGGAGAAATGCAAGAGGAAACTCAGAGGACTCATTGCTGAGAAACACTGTGCCCCTATCATTCTTCGCTTGGCG
TAAGTTTATCTTTAAACTTTCTTAATTAAGATCACTTTCAGTGACCATCGTTGATGCGTTATTAATCTGCATGATGATGAGTATTAGATCAAAATCAAGNNNNNNNNNNNNNNNNNNNNN
NNNNNNAGTTTTTGGGCTGCACATATGCAGATGGCACTCAGCGGGGACTTATGACGTGAACACGAAGACAGGAGGGCCTTTTGGGACGATCAGGCACCCAGATGAGCTTGCTCATGAGGC
TAACAATGGTCTTGATATTGCTGTCAGGCTCTTGGAGCCCATCAAGCAGCAGTTTCCTATCTTGTCCTACGCTGATTTCTATCAG
GTAATTATTATTTATATCCAACTGTTGACTACAGA
AAATGATTTGCTTTATGATCACTTTCTATGGATTACTTTGGATTGGTGAATTGACCATGGTTTGTGTTTTATTTTCTTGAAGTTGGCTGGAGTTGTTGCCGTTGAAGTTACCGGAGGGCC
TGAAATACCTTTCCACCCTGGAAGACCG
GTGAGGGCTTTTCATATGCATGTTCTCTAAATTAGAATTGATTTCTTGTTGCAAAAGTTCATCTGTAAAACATAGCTGTAGCTTTTGTACAT
TCCCAAAATGATGGTGTGTTTTTCCGAAATAAAATTTTGTTGATCAGCATCTTGGACTAGGCTTCACTTAGAAGGTTTTGTTAGAAGATCAGCAATGCATAATTAAATAGATGTGAGTCA
CTTGCTGGAAACTCAGGGCCTTTACTTGACGTGTGTGATGTGTACGCCATTCCTATTATGCATAATTTCTATTTATGTTACTGTCACTAGTGTACAATTATATTGATGTCTATTCATGTG
TTTGATTTACAATTAAATGAATGAAAAGAATAATAATAACAATAAACCAGGGCATCCTCATTCTGTCGTCCATTTGGATTGTATTGAAGCAACAGAGAAAGCAACTAATCTATCCAAATA
ATATAGCTTGTTGATAGCTAAGCAATTTTAGAAGGCAGCTGCAAAGATTGAACTATTGATGCTGAACTGGTATTCTTTATATTAAGTTCTAAACATCTCGTGTTGCAGGACAAATCTGAT
CCGCCCCCAGAAGGTCGCTTGCCAAATGCCACCAAAG
GTCAGTTTCAGATAATTTGCTCAGGTTTAAATCATTGTAAAATCAGTACAGTGTATCTTCCTACAAATTAAGTCACTTACTCC
TTTTGTTATCATCACTGCAGGTTCTGACCATTTGAGAGATGTCTTCGGCCACATGGGTCTGAGTGATAAGGATATTGTTGTTTTATCCGGCGGTCATACATTGGTCTGTGAGCTAACATT
GCAGTAGTTCTATATTCTTCCATGGACTGCTGCTTGTTTTTGAAAGCACGATGCAATTTAACATCTTTAGCTTGTTGTACTCACTTGTAATGTTGGTCTCATGGGAATCCTTGTACAGGG
TAGGTGCCACAAGGAGCGTTCTGGATTTGAAGGACCCTGGACTAACAATCCACTTATTTTTGACAATTCATATTTTAA
GTAATAAGCACATTTATCATTCTTCGTACTTTCACAAGTTCT
TTTTATATGGGGCCTCATTCAAATTTACGTGTCTCAGAGCAGCAGACTGATGTGAATTATTTCATTATTTTAATTTGATAGGGAATTGCTGAGTGGAGAGAAAGAAGGTCTACTTCAGCT
GCCATCAGACAAGGCTCTTCTCGAGGACCCAGTGTTTCGTCCTCTTGTTGAAAAATATGCTGCA
GTAAGTACCTGGCCATATTTTTATATTGATTTTATTTATGGAATTGGTCGCAATGT
CTACGAAACTTACTGTGTTGTGGTGACATTGCTTCAGGATGAGGATGCCGTCTTTGCAGATTACGCTGAAGCTCATTTGAAGCTCTCAGAACTCGGGTTAGTCTTCTATGACTTCTCTTC
ACCTATTACCTAGTCCTTTAATCATTTAATCATGCGTGCTTCTACTTGAGTATTGACTTGTGAATTTCTATTTCCTCCTCCAGATTTGCGGATGCTGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAAGTGTTATCCAAAAGTGAGCGATGAGTATCAGAAAGCAGTGGAGAAATGCAAGAGGAAACTCAGAGGACTCATTGCTGAGAAACACTGTGCCCCTATCATTCTTCGCTTGGCA
TGGCACTCAGCGGGGACTTATGACGTGAACACGAAGACAGGAGGGCCTTTTGGGACGATCAGGCACCCAGATGAGCTTGCTCATGAGGCTAACAATGGTCTTGATATTGCTGTCAGGCTC
TTGGAGCCCATCAAGCAGCAGTTTCCTATCTTGTCCTACGCTGATTTCTATCAG
TTGGCTGGAGTTGTTGCCGTTGAAGTTACCGGAGGGCCTGAAATACCTTTCCACCCTGGAAGACCG
GACAAATCTGATCCGCCCCCAGAAGGTCGCTTGCCAAATGCCACCAAAGGTTCTGACCATTTGAGAGATGTCTTCGGCCACATGGGTCTGAGTGATAAGGATATTGTTGTTTTATCCGGC
GGTCATACATTG
GGTAGGTGCCACAAGGAGCGTTCTGGATTTGAAGGACCCTGGACTAACAATCCACTTATTTTTGACAATTCATATTTTAAGGAATTGCTGAGTGGAGAGAAAGAAGGT
CTACTTCAGCTGCCATCAGACAAGGCTCTTCTCGAGGACCCAGTGTTTCGTCCTCTTGTTGAAAAATATGCTGCA
GATGAGGATGCCGTCTTTGCAGATTACGCTGAAGCTCATTTGAAG
CTCTCAGAACTCGG
ATTTGCGGATGCTGAGTAA

Retrieve as FASTA